KEGG   Drosophila willistoni: Dwil_GK10305Help
Entry
Dwil_GK10305      CDS       T01067                                 

Definition
GK10305 gene product from transcript GK10305-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dwi  Drosophila willistoni
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dwil_GK10305
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dwil_GK10305
   00603 Glycosphingolipid biosynthesis - globo series
    Dwil_GK10305
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dwil_GK10305
   00511 Other glycan degradation
    Dwil_GK10305
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dwil_GK10305
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dwil_GK10305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 624 aa AA seqDB search
MPDQTSYKHCYHWGAWSALCLTAAAAAITAFAPVAYANDSSETSSNRISGRSKWLCSSTD
ICTSEDEQVPGVQYLSHQFESQRDCRLSCGKYGSIWPMPTGDECSLSHERVHFDPWKVRF
NVVAPNDVTTQFLHETNRLFVSNLLKECTRNCTLASSKEVLVKATVQSNSLVLDWTTDES
YMMVVRSTDKVTFVDIKAPTVYGARHAFETLSNLVTGSITNGLLLVSAARITDRPVFPHR
GVLLDTSRNFLPLRYIRSTIDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQRFGAYSTA
QTYSRADAVNLVKYARLRGIRVLIEIDGPSHAGNGWQWGPSAGLGNISVCLNQSPWRKYC
VQPPCGQLNPINDHMYAVLKEIFEDIAELGAPEETIHMGGDEVFLPCWNNTKEITDVMVA
RGYDLGVLSFLRLWSQFHQRNLDAWDDINQRMFPNNKEPKPVILWSSHLTDPKTIEEFLP
KERFIIQTWVSAADSLNRELLQRGYRILISTKDAWYLDHGFWGSTNYYNWKTVYGNALPS
GARKDQVLGGEVCMWSEYVDQNSLEARIWPRAGAAAERLWSNPKSSALLAQRRFYRYRER
LLARGIHADAVTPHWCVLHEGNCL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccagactagttacaaacattgttatcattggggtgcatggagtgctctctgc
ctcacagctgcagctgcagcaatcactgcatttgcaccagttgcatacgccaacgatagc
tctgagacgtccagcaatagaatcagcggcagaagtaaatggctgtgcagttcaacggat
atctgcacttcagaagatgaacaagttccgggtgtccagtacttgtcacatcaattcgag
agtcaacgcgattgccgtctatcgtgtggcaaatatggatccatttggccaatgcccact
ggggatgagtgctccctgtcccatgagcgggtgcattttgatccatggaaggtacgcttc
aacgtggtggcccccaatgatgtgaccacacagtttttacacgaaacgaatcgattgttc
gtaagcaatttactcaaggaatgtacccgcaattgcactttggccagcagtaaggaggtc
cttgtcaaggctacagtgcaatcgaatagcttggtattggactggaccacggatgagagc
tatatgatggtggtgcgtagcacagataaagtcacatttgtcgatatcaaggcgccaaca
gtttatggggcccgacatgcctttgagacgctgagtaatttggttaccgggagcataacg
aatggattgcttctggtcagtgcggcacggataacagatcgtccagtttttccacatcgt
ggtgtgctcttggatacctctaggaatttcctaccattgcgatacataagaagcactata
gatgccatggccgcatccaaattgaatgtcctgcattggcatgtggtggacacacatagt
tttcccctagagataacccgtgtaccggaaatgcaacgttttggtgcctattctacggca
cagacctattcccgggcagatgccgtcaacttggtaaaatatgcccgtctccggggtatt
cgtgtcctgatcgaaatcgatggtccctcacatgcaggcaacggctggcaatggggtccc
agtgccggcttgggcaatatatccgtatgcctgaatcaatcgccatggcgaaagtattgc
gtccaaccgccatgtgggcaacttaatcccataaatgatcacatgtacgctgtgctaaag
gagattttcgaagatattgccgaactgggtgcacccgaagagaccatacacatgggtggc
gatgaggtattcctgccctgctggaacaataccaaagagataaccgatgttatggtagct
cggggctatgacctcggagttttgagtttcctgcgtctatggtcgcagttccatcagcgt
aatctcgatgcctgggatgatatcaatcagcgcatgtttccgaataataaggaaccaaaa
ccagtgatattatggtccagtcatttgacagatccgaaaactattgaggaatttctaccc
aaggaacgtttcatcatccaaacctgggtgagtgctgcagattccctgaatcgggaactc
ttgcagcggggctatcgtattttgatatccaccaaggatgcttggtatctggatcatggt
ttctggggctccaccaactactacaattggaagactgtctatggcaatgccttgccctca
ggtgcacgcaaggatcaagtgcttggtggtgaggtgtgcatgtggagtgaatatgttgat
caaaattcattggaggcccgcatttggccaagagctggagctgctgccgaaagactttgg
tcgaatccgaaatcatctgccctgttggcccaaagacgcttctatcgctatcgtgagcgt
ctattggcacgtggcatacacgcggatgcggttacgccacattggtgtgttctgcatgag
ggcaattgcctttag

DBGET integrated database retrieval system