KEGG   Drosophila willistoni: Dwil_GK10305Help
Entry
Dwil_GK10305      CDS       T01067                                 

Definition
GK10305 gene product from transcript GK10305-RA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dwi  Drosophila willistoni
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dwi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dwi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:dwi00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dwi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dwi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dwi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 624 aa AA seqDB search
MPDQTSYKHCYHWGAWSALCLTAAAAAITAFAPVAYANDSSETSSNRISGRSKWLCSSTD
ICTSEDEQVPGVQYLSHQFESQRDCRLSCGKYGSIWPMPTGDECSLSHERVHFDPWKVRF
NVVAPNDVTTQFLHETNRLFVSNLLKECTRNCTLASSKEVLVKATVQSNSLVLDWTTDES
YMMVVRSTDKVTFVDIKAPTVYGARHAFETLSNLVTGSITNGLLLVSAARITDRPVFPHR
GVLLDTSRNFLPLRYIRSTIDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQRFGAYSTA
QTYSRADAVNLVKYARLRGIRVLIEIDGPSHAGNGWQWGPSAGLGNISVCLNQSPWRKYC
VQPPCGQLNPINDHMYAVLKEIFEDIAELGAPEETIHMGGDEVFLPCWNNTKEITDVMVA
RGYDLGVLSFLRLWSQFHQRNLDAWDDINQRMFPNNKEPKPVILWSSHLTDPKTIEEFLP
KERFIIQTWVSAADSLNRELLQRGYRILISTKDAWYLDHGFWGSTNYYNWKTVYGNALPS
GARKDQVLGGEVCMWSEYVDQNSLEARIWPRAGAAAERLWSNPKSSALLAQRRFYRYRER
LLARGIHADAVTPHWCVLHEGNCL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccagactagttacaaacattgttatcattggggtgcatggagtgctctctgc
ctcacagctgcagctgcagcaatcactgcatttgcaccagttgcatacgccaacgatagc
tctgagacgtccagcaatagaatcagcggcagaagtaaatggctgtgcagttcaacggat
atctgcacttcagaagatgaacaagttccgggtgtccagtacttgtcacatcaattcgag
agtcaacgcgattgccgtctatcgtgtggcaaatatggatccatttggccaatgcccact
ggggatgagtgctccctgtcccatgagcgggtgcattttgatccatggaaggtacgcttc
aacgtggtggcccccaatgatgtgaccacacagtttttacacgaaacgaatcgattgttc
gtaagcaatttactcaaggaatgtacccgcaattgcactttggccagcagtaaggaggtc
cttgtcaaggctacagtgcaatcgaatagcttggtattggactggaccacggatgagagc
tatatgatggtggtgcgtagcacagataaagtcacatttgtcgatatcaaggcgccaaca
gtttatggggcccgacatgcctttgagacgctgagtaatttggttaccgggagcataacg
aatggattgcttctggtcagtgcggcacggataacagatcgtccagtttttccacatcgt
ggtgtgctcttggatacctctaggaatttcctaccattgcgatacataagaagcactata
gatgccatggccgcatccaaattgaatgtcctgcattggcatgtggtggacacacatagt
tttcccctagagataacccgtgtaccggaaatgcaacgttttggtgcctattctacggca
cagacctattcccgggcagatgccgtcaacttggtaaaatatgcccgtctccggggtatt
cgtgtcctgatcgaaatcgatggtccctcacatgcaggcaacggctggcaatggggtccc
agtgccggcttgggcaatatatccgtatgcctgaatcaatcgccatggcgaaagtattgc
gtccaaccgccatgtgggcaacttaatcccataaatgatcacatgtacgctgtgctaaag
gagattttcgaagatattgccgaactgggtgcacccgaagagaccatacacatgggtggc
gatgaggtattcctgccctgctggaacaataccaaagagataaccgatgttatggtagct
cggggctatgacctcggagttttgagtttcctgcgtctatggtcgcagttccatcagcgt
aatctcgatgcctgggatgatatcaatcagcgcatgtttccgaataataaggaaccaaaa
ccagtgatattatggtccagtcatttgacagatccgaaaactattgaggaatttctaccc
aaggaacgtttcatcatccaaacctgggtgagtgctgcagattccctgaatcgggaactc
ttgcagcggggctatcgtattttgatatccaccaaggatgcttggtatctggatcatggt
ttctggggctccaccaactactacaattggaagactgtctatggcaatgccttgccctca
ggtgcacgcaaggatcaagtgcttggtggtgaggtgtgcatgtggagtgaatatgttgat
caaaattcattggaggcccgcatttggccaagagctggagctgctgccgaaagactttgg
tcgaatccgaaatcatctgccctgttggcccaaagacgcttctatcgctatcgtgagcgt
ctattggcacgtggcatacacgcggatgcggttacgccacattggtgtgttctgcatgag
ggcaattgcctttag

DBGET integrated database retrieval system