KEGG   Drosophila willistoni: Dwil_GK10327Help
Entry
Dwil_GK10327      CDS       T01067                                 

Definition
GK10327 gene product from transcript GK10327-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dwi  Drosophila willistoni
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dwi01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dwi00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dwi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 303 aa AA seqDB search
MHLMNFVSFVLLVLVYLINSHVASGENATVLPVVLWHGMGDTCCLPFSLGSIKKLIEEQT
NGTYVYSLKIGGNIVLDYESGFFIHPNKQVDYACKRLAQDKRLANGYNAIGFSQGGQFLR
AVAQRCPEPPMRTLISLGGQHQGVFGLPKCPTLSTSTCESISKLLNVAAYEDWVQDELVQ
ATYWHDPWHQNRYRTKSSFLADINNELLINKGYSENINKLRRFVMVKFLNDTIVQPKESQ
WFQFYIPGQDRLIQPLNETKVYQDLGLDLMHEQGKLQYLSTEGDHLAISKEWFIKNLVPL
LLD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgatgaactttgtctcgttcgtgctcctggtcctggtttacctgataaatagt
catgtagcttcaggtgaaaatgcaacagttctacctgtcgtcctgtggcatggcatgggc
gatacttgctgcctgccgttcagtttgggctccattaagaaactgatcgaggagcagaca
aacggcacttatgtctactccctgaagattggcggcaacattgtcctggactatgagagt
ggcttctttatacatcccaataagcaggtggactacgcctgcaaacgtctggcccaggat
aagcgcctggccaatggctacaatgccattggtttctcccagggtggccaatttctgcga
gctgtggcccaacgttgtccagagccaccaatgcgtacgttaattagtctgggcggtcag
catcagggtgtctttggtctacccaagtgtccaacattaagcaccagtacctgtgaatcc
attagcaagctactgaatgttgccgcctatgaagattgggtccaagatgaactagtccaa
gccacctattggcatgatccatggcatcagaatagatatagaacaaaaagctcttttctg
gcggatattaacaatgaattgctcatcaataaaggctattccgagaatatcaataagcta
agaaggtttgttatggtcaaatttctaaacgataccatagtccagcccaaagagtcacaa
tggtttcagttctatatacccggacaggatcgtctcatccagcctttaaatgagacaaaa
gtctatcaggatttgggtctggacttaatgcatgaacagggtaaacttcaatatcttagc
actgagggcgatcatttggccatatcaaaggaatggtttataaaaaatttagttcccctg
ctattagactaa

DBGET integrated database retrieval system