KEGG   Drosophila willistoni: Dwil_GK10327Help
Entry
Dwil_GK10327      CDS       T01067                                 

Definition
GK10327 gene product from transcript GK10327-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dwi  Drosophila willistoni
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dwil_GK10327
  Lipid metabolism
   00062 Fatty acid elongation
    Dwil_GK10327
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dwil_GK10327
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dwil_GK10327
Lipid biosynthesis proteins [BR:dwi01004]
 Fatty acid synthase
  Component type
   Dwil_GK10327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 303 aa AA seqDB search
MHLMNFVSFVLLVLVYLINSHVASGENATVLPVVLWHGMGDTCCLPFSLGSIKKLIEEQT
NGTYVYSLKIGGNIVLDYESGFFIHPNKQVDYACKRLAQDKRLANGYNAIGFSQGGQFLR
AVAQRCPEPPMRTLISLGGQHQGVFGLPKCPTLSTSTCESISKLLNVAAYEDWVQDELVQ
ATYWHDPWHQNRYRTKSSFLADINNELLINKGYSENINKLRRFVMVKFLNDTIVQPKESQ
WFQFYIPGQDRLIQPLNETKVYQDLGLDLMHEQGKLQYLSTEGDHLAISKEWFIKNLVPL
LLD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgatgaactttgtctcgttcgtgctcctggtcctggtttacctgataaatagt
catgtagcttcaggtgaaaatgcaacagttctacctgtcgtcctgtggcatggcatgggc
gatacttgctgcctgccgttcagtttgggctccattaagaaactgatcgaggagcagaca
aacggcacttatgtctactccctgaagattggcggcaacattgtcctggactatgagagt
ggcttctttatacatcccaataagcaggtggactacgcctgcaaacgtctggcccaggat
aagcgcctggccaatggctacaatgccattggtttctcccagggtggccaatttctgcga
gctgtggcccaacgttgtccagagccaccaatgcgtacgttaattagtctgggcggtcag
catcagggtgtctttggtctacccaagtgtccaacattaagcaccagtacctgtgaatcc
attagcaagctactgaatgttgccgcctatgaagattgggtccaagatgaactagtccaa
gccacctattggcatgatccatggcatcagaatagatatagaacaaaaagctcttttctg
gcggatattaacaatgaattgctcatcaataaaggctattccgagaatatcaataagcta
agaaggtttgttatggtcaaatttctaaacgataccatagtccagcccaaagagtcacaa
tggtttcagttctatatacccggacaggatcgtctcatccagcctttaaatgagacaaaa
gtctatcaggatttgggtctggacttaatgcatgaacagggtaaacttcaatatcttagc
actgagggcgatcatttggccatatcaaaggaatggtttataaaaaatttagttcccctg
ctattagactaa

DBGET integrated database retrieval system