KEGG   Drosophila willistoni: Dwil_GK10374Help
Entry
Dwil_GK10374      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11252  histone H2B
Organism
dwi  Drosophila willistoni
Brite
Chromosome and associated proteins [BR:dwi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dwil_GK10374
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK10374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6646539
NCBI-ProteinID: XP_002069212
FlyBase: FBgn0212389
UniProt: B4MHM9
Position
Unknown
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaactagtggaaaagcagccaagaaggctggcaaggctcaaaagaacatc
accaagaatgacaaaaagaagaagcgcaagcgtaaggagagctatgctatttacatttac
aaagtgttaaagcaagtccacccagacactggtatttcttcaaaagcaatgagcataatg
aatagctttgtaaacgatatttttgaacgtattgctgctgaggcctcccgcttggcccac
tacaataagaggtcgaccatcaccagtcgcgaaatccaaacggctgttcgtttgcttttg
ccgggtgagcttgctaagcacgctgttagtgagggaacaaaagctgtcaccaagtatacc
agctcaaagtaa

DBGET integrated database retrieval system