KEGG   Drosophila willistoni: Dwil_GK10422Help
Entry
Dwil_GK10422      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K16172  insulin receptor substrate 1
Organism
dwi  Drosophila willistoni
Pathway
dwi04068  FoxO signaling pathway
dwi04140  Autophagy - animal
dwi04150  mTOR signaling pathway
dwi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dwil_GK10422
   04150 mTOR signaling pathway
    Dwil_GK10422
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dwil_GK10422
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dwil_GK10422
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 6652608
NCBI-ProteinID: XP_015031975
FlyBase: FBgn0212437
UniProt: A0A0Q9X6N3
Position
Unknown
AA seq 311 aa AA seqDB search
MNVLNVYPGGRSDLVPEPMRKRSSSANEASKPINVLHKRQNVFDVRSTASPHNYGYGRER
CDSLPTRNITFIDSSHQTYIVSTSGVRSNSISGGRPQSANRHITSSPLNTPMRCSESEES
SISIDESDDPGSFCHYRLNTRASKGIILEENSDDFTIGDLHKKPGQNENTGNYVPMTPIK
PPETQNPNKIPKLNCVRSQNVENSSTQYIFPEHASEKFGKEFDTDSDNQYERPTRAYSIG
SKIESSKSRQRLGYLNDLEKSSFRVRAYSVGSKTKTPNSDGNSFGVVNKVQKEEKWDIYK
IYEKLNIPVHR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtattaaacgtttatccaggtggaagatctgatctagttcctgaacctatgaga
aaacgttcatcatcagcaaatgaagcatctaaaccaatcaacgtgttacacaagcgacaa
aatgtttttgatgtaagaagtactgcatctccccataattatgggtatggacgagagaga
tgcgatagtttgccgacaagaaatataacttttattgacagcagccaccaaacatacatt
gtctcaactagtggtgtcagaagcaattccatatctggtggccgtccacaatcagccaat
aggcatattaccagctcaccattaaacactccaatgagatgctccgagtctgaagaatct
tctataagtattgatgaatctgatgatcccggaagcttttgccattaccgattaaacact
cgggcatcaaagggcattattcttgaggaaaattctgatgatttcactattggtgacctt
cataaaaaacctggacagaatgagaatactggcaattatgtaccaatgacacctattaag
ccaccagaaacacagaaccccaataaaatcccgaagttgaactgcgttaggtcccaaaat
gtggaaaacagcagcacgcaatatatttttcctgagcatgcgtctgagaaatttggaaag
gaatttgatacagattccgacaatcaatatgaaaggccaactcgtgcctattccataggc
agtaaaattgaaagttccaaaagcagacaacgactgggctatttaaatgacttggaaaaa
agttcttttcgggtacgagcgtactcagttggatccaaaacaaaaactcctaatagcgat
ggtaatagttttggtgtagttaataaggttcagaaagaagagaagtgggacatctacaaa
atctacgaaaaattaaatataccagtgcaccgctag

DBGET integrated database retrieval system