KEGG   Drosophila willistoni: Dwil_GK10422Help
Entry
Dwil_GK10422      CDS       T01067                                 

Definition
GK10422 gene product from transcript GK10422-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dwil_GK10422
   04150 mTOR signaling pathway
    Dwil_GK10422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 929 aa AA seqDB search
MATTMEDGVVLKGYHKKLKTMKKKYFVLYKETPHGASRLEYFDSEKKFVQRTEPKRVIYL
KNCFNINRRFDTKHKFVVVLSTREGGFGIVLDSENDLRKWLDQLLFLQRDNANITDEVNS
SYDHVWQVTIQKKGISEKAGISGSYHCCLTSKSLTFLCIEPNKPQSGANRLPKVEILLTT
IRRCGHASPQCIFYMELGRQSVLGSGELWMETDDASTSRNMHDMILSAMSAKSEPNMNVL
NVYPGGRSDLVPEPMRKRSSSANEASKPINVLHKRQNVFDVRSTASPHNYGYGRERCDSL
PTRNITFIDSSHQTYIVSTSGVRSNSISGGRPQSANRHITSSPLNTPMRCSESEESSISI
DESDDPGSFCHYRLNTRASKGIILEENSDDFTIGDLHKKPGQNENTGNYVPMTPIKPPET
QNPNKIPKLNCVRSQNVENSSTQYIFPEHASEKFGKEFDTDSDNQPTRAYSIGSKIESSK
SRQRLGYLNDLEKSSFRVRAYSVGSKTKTPNSDGNSFGVVNKGKLDLYSKGSQSNVSTKS
SSERREVGHLQNLRKIKYTSAPLVNSDKLSDLMEIDFSKVAATQKLQISNVQETKMCNKN
DTWKSSINVNNNGVDNINLLNSSHRFFSGAYLEMKPVGNVYCDYNIDNVSNKVEMLKLNN
SVSPQLIDDTENSSRNNCKMCNRASGNLNNIMWNKNSLNDAKVDHIPHQEEETNPKLANS
TSFGNRQQGNVAKVDSEKINMQMYDVFGVVPILPDEKRLIHSISNEDNTHNSTDPKDPTK
HGEAGYKMLQIRSDSSLLLTKTIQRGVCKEHIERKNRDLGNMNLLTAKESGVIITSKCNK
TFATSESETKETKNLNSSLRPPSRISQPELYYASLDLPQSSLPISSICLKQGSCDSSQAV
IISEIENSYAKIDFDQSDSSSSSSKICNV
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggccactacaatggaagacggagtagtattaaaaggatatcacaagaaactgaaaacc
atgaagaaaaaatattttgttctttataaggaaacaccccatggtgcatctagattggag
tatttcgattccgaaaaaaagtttgttcaaaggaccgaacctaaacgagttatatactta
aagaactgttttaatataaaccgtcgttttgacaccaaacataaatttgttgtagtgctt
tcgacccgcgaaggtgggtttggaatagtcttggatagtgagaacgacttacggaaatgg
ctagatcaattattgtttctacaaagggataacgcaaacattactgatgaagtaaattca
tcatacgatcatgtttggcaagttacaattcaaaaaaaaggaatatctgaaaaagcggga
atttctggaagctatcattgttgtttaacttcaaagtctttaactttcttgtgtattgag
ccgaataaaccacaaagtggtgctaatcgacttcctaaagttgaaatacttttaacaaca
ataagacgatgtggacacgcctctcctcagtgtattttttatatggagctgggtcgacag
agtgttttgggttctggtgagttgtggatggagacagatgatgcgtcgacttccagaaat
atgcatgatatgattctaagtgcgatgtctgctaaatctgaaccaaacatgaacgtatta
aacgtttatccaggtggaagatctgatctagttcctgaacctatgagaaaacgttcatca
tcagcaaatgaagcatctaaaccaatcaacgtgttacacaagcgacaaaatgtttttgat
gtaagaagtactgcatctccccataattatgggtatggacgagagagatgcgatagtttg
ccgacaagaaatataacttttattgacagcagccaccaaacatacattgtctcaactagt
ggtgtcagaagcaattccatatctggtggccgtccacaatcagccaataggcatattacc
agctcaccattaaacactccaatgagatgctccgagtctgaagaatcttctataagtatt
gatgaatctgatgatcccggaagcttttgccattaccgattaaacactcgggcatcaaag
ggcattattcttgaggaaaattctgatgatttcactattggtgaccttcataaaaaacct
ggacagaatgagaatactggcaattatgtaccaatgacacctattaagccaccagaaaca
cagaaccccaataaaatcccgaagttgaactgcgttaggtcccaaaatgtggaaaacagc
agcacgcaatatatttttcctgagcatgcgtctgagaaatttggaaaggaatttgataca
gattccgacaatcagccaactcgtgcctattccataggcagtaaaattgaaagttccaaa
agcagacaacgactgggctatttaaatgacttggaaaaaagttcttttcgggtacgagcg
tactcagttggatccaaaacaaaaactcctaatagcgatggtaatagttttggtgtagtt
aataagggtaagcttgacctatactccaaaggaagtcaaagtaatgtttcaaccaaaagc
agttcagaaagaagagaagtgggacatctacaaaatctacgaaaaattaaatataccagt
gcaccgctagtaaattctgataaattgagtgatctgatggaaattgatttttccaaagtt
gcagcaacacaaaaattacagattagtaatgttcaggaaactaagatgtgcaacaaaaac
gatacttggaaatcatcaattaatgtaaataataatggagtggataacattaatttgctt
aacagcagtcaccgttttttttctggtgcgtacttagaaatgaaacctgttggcaatgtt
tattgtgattataatatagacaatgtttctaataaagttgaaatgctcaagctgaacaat
tcagtaagtccacaattaatagatgatactgaaaatagcagtcgtaataactgtaagatg
tgcaatagggcatccggaaatttgaataatataatgtggaataaaaactctttaaatgat
gccaaagtagatcacatacctcaccaagaggaggaaactaatcccaaattggctaattca
acaagttttggaaatcgccaacaaggaaatgttgcaaaagtcgactcggaaaaaataaat
atgcaaatgtatgatgtttttggtgtggtccctatacttcctgatgagaaaaggttaata
cattcaattagtaatgaagataatactcataattcaactgacccaaaagatccaacgaaa
catggagaagctggttacaaaatgcttcagataagaagtgatagttcccttttattaaca
aaaacaatccaaagaggagtatgtaaagaacatattgagagaaaaaacagagatctagga
aacatgaatttgctcacagcaaaagaatccggcgtaataataacctcaaagtgtaataaa
acttttgcaacatccgaatctgaaactaaagaaactaaaaatctgaactcttcgctgcga
ccgccgtcacgtatatctcaaccggaattgtattatgcaagcttagatcttccacaaagt
agtttgccgatttcatcgatttgtttaaaacaagggtcatgtgactcttcgcaagcggta
attatttcggaaattgaaaattcatatgcgaaaatcgactttgatcagtcagactcatca
tcttcttcttctaaaatatgtaacgtgtaa

DBGET integrated database retrieval system