KEGG   Drosophila willistoni: Dwil_GK10672Help
Entry
Dwil_GK10672      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dwi  Drosophila willistoni
Pathway
dwi00330  Arginine and proline metabolism
dwi01100  Metabolic pathways
dwi01230  Biosynthesis of amino acids
Module
dwi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dwil_GK10672
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Dwil_GK10672
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dwil_GK10672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 6645496
NCBI-ProteinID: XP_002068050
FlyBase: FBgn0212685
UniProt: B4N4G2
Position
Unknown
AA seq 777 aa AA seqDB search
MMLRNSLNLANGLRNGFASNAWRAVSSHGPRQPLVSPEKRLERSHPTFTERSQLKYARRL
VVKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLM
SLSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFY
NEETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAM
LAAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDSNSIEFGKKSKVGTGGMDSKV
KAATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANSVPVEVMAENARTGS
RQMQALTAGQRASAVNTLADLLVSREKFILDANAKDLAEAKKNGLAKPLLSRLSLTSAKL
KNLSIGLKQIAEDSHKNVGRVLRRTRLAENLELKQVTVPIGVLLVIFESRPDSLPQVAAL
AMASANGLLLKGGKEAAYSNKALMELVKEALTSVGAEHAVSLVSTREEISDLLSMENHID
LIIPRGSSELVRSIQQQSLHIPVLGHAEGVCHVFIDKDADLKKALRIARDAKCDYPAACN
AMETLLIHEDLMSGDIFTDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALEC
CIEIVPSLEDAINHIHTYGSGHTDVIVTENDARAKQFLGSVDSACVFHNASSRFADGFRF
GLGAEVGISTVRIHARGPVGVEGLLTTKWILNGQDHAAADFAEGGQRTWLHETLPLD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgcgcaatagccttaacttggccaatggattacgcaacggcttcgccagcaat
gcctggcgagctgttagctctcatggtcccagacagccactggtttcgcctgagaaacgc
ctggagagatctcatcccacattcacggaacgtagtcagttaaaatatgctcgacgtttg
gttgtgaaactgggaagtgctgtgataacacgtgaggacaatcatggattggctctggga
cgattggcatcaattgtggagcaggtagccgaatgtcatttagagggacgcgaagttatg
atggtcaccagcggcgctgtagcatttggaaaacagaaactggcacaggagctgctcatg
tccctttccatgcgtgagactcttaatcccaaggacagcaaagagttcgatggcgccaca
ctggaaccacgtgcggctgctgcggtgggtcagtcgggtcttatgtctctctatgatgct
atgtttgcccaatatggcgtcaagattgcacaggtgcttgttaccaaaccggatttctac
aatgaggaaacacgcaacaatctcttctgcacgctctccgaattaattagcctaaatatt
gtgccaatcataaatacgaacgatgccgtttcgccaccaatgtttatacgtgacgatgag
ccagccggtggtgcgagaaggggtatacccattaaggacaacgacagtttgtcggccatg
ttggccgctgaagtacaagcggatttactaatccttatgtcggatgtcgatggcatttac
aataagccaccatgggaagatggtgccaagctcatgcacacctacacaagcgacgatagc
aacagcattgaatttggaaaaaagtcaaaggtgggcactggcggcatggactccaaagtg
aaagcagccacttgggcattagatcgtggtgtcagcgttgtaatttgcaatggtatgcag
gagaaggccattaagacaataattggcggtagaaaggttggaacattctttaccgaggca
acggaaagtgccaattcagtgcccgtcgaagtgatggccgagaacgctcgtactgggagc
cgtcaaatgcaggcactgactgccggccaacgtgccagcgctgttaacacattggccgat
cttttggttagtcgcgagaaattcatactcgatgccaatgccaaggatttggctgaggca
aagaaaaatggtctggccaagccattgctgtcgcgtttgtcattaacttcagcgaaattg
aagaacttgtccattggcctgaagcaaattgccgaggatagtcacaagaatgtgggacgt
gtcctacgtcgtacacgtttggccgagaatttggaactgaaacaggttacagtgccaatt
ggtgtgctattggtcatcttcgaatcccgtccagattcattgccccaagtggctgcctta
gccatggcctcggcgaatggtctattactcaaaggcggcaaagaggctgcttacagtaat
aaagcactcatggaattggttaaggaggcattgaccagcgttggtgccgaacatgcagta
tccttagtttctactcgcgaggaaatcagcgatctgctgtccatggaaaatcacattgat
ctaatcataccacgcggctcatcggaattagtacgtagcattcaacagcaatcattgcat
atacctgtattaggtcatgcggaaggtgtgtgccatgtctttatcgataaagatgccgat
ttgaaaaaggctttgcgtattgcccgtgatgccaaatgcgattatccagcagcctgcaat
gcaatggaaacattactcatccacgaggatctaatgagcggggacattttcactgatgtc
tgcaacatgcttaaacgtgagggtgttaaaatctatgctggaccaagattaaatcagcaa
ctaaccttcggaccaccggcggcaaagagtctaaagcatgaatatggtgccctagagtgt
tgcattgagattgtacccagtttggaggatgccattaatcacatacatacatatggcagc
gggcataccgatgtcattgttaccgaaaatgatgccagagcaaagcaattccttggtagc
gtggacagtgcctgtgtattccataatgccagttcacgttttgcggacggtttccgtttt
ggccttggcgccgaggttggcatctcaacggtacgcattcatgcccgtggcccagttggt
gtagagggtctattaaccaccaaatggatactcaatggacaggatcatgcggcagctgat
tttgccgaaggcggtcaacgtacctggttgcatgagacactgccattggattga

DBGET integrated database retrieval system