KEGG   Drosophila willistoni: Dwil_GK10850Help
Entry
Dwil_GK10850      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17610  calcineurin B homologous protein 1
Organism
dwi  Drosophila willistoni
Brite
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dwil_GK10850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RE_XamI
Motif
Other DBs
NCBI-GeneID: 6647886
NCBI-ProteinID: XP_002070767
FlyBase: FBgn0212861
UniProt: B4N9Z8
Position
Unknown
AA seq 189 aa AA seqDB search
MGNKSSLFLLNEEIAQIQDETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESSDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggaataaatcatcattgttcctccttaacgaggaaatcgcacaaattcaagatgag
acaggctttactcccaatcaaattgaacgtttatactcacggttcacctcactggatcgc
aacgactgcggtacactctctcgggaggatttgatgcgcataccagaattggcaattaat
cctctatgtgagcgtattgttcattccttttttgctgagagctccgatgaccgagtcaac
tttcgccaattcatgaatgttttggcccatttccgaccgctgcgtgataataagcaaagc
aaactgaacagccgtgaggagaaattgaaatttgcattcaaaatgtacgatctggatgat
gatggtgtaatcagccgggatgagttgctttccatcctgcatatgatggtgggcgccaat
atcagtcaggaccaattagttagcatagcagagcggactatattggaggcggatctatgc
tgtcagggcaaaatctcatttgaggacttttgcaaagccctagatcgtacggatgtcgat
caaaaaatgtcaattaggttcctcaactaa

DBGET integrated database retrieval system