KEGG   Drosophila willistoni: Dwil_GK10873Help
Entry
Dwil_GK10873      CDS       T01067                                 

Definition
GK10873 gene product from transcript GK10873-RA
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dwil_GK10873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 342 aa AA seqDB search
MKPLSEKVYQEDRKLDEVVWLRREDVGSSKLPIVYSKKYAVRFAGLEKLHPFDAAKGKHI
HKRLCAELLLGNGDFYEPKEVTKEQLRRIHTRKYLTSLECSMNVASIAEVPLLSFVPNTY
VQSCYLRPMRFQTAGSILAGKLALEYGWSINLGGGFHHCCTSKGGGFCPYADISMLVVRL
FELEPFRVQRIMIVDLDAHQGNGHERDFHNVAAVYILDMYNASIYPKDHEAKTTIRCAVE
LRPRTEDSFYLKKLAQCLKTAVAEFKPNVVIYNAGTDILDGDPLGNLAITPGGVMERDRL
VFSTFRALNIPIIMLLSGGYVKKSACVIADSIVNLRRKGLLN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccactatcagaaaaagtgtatcaggaggataggaagcttgatgaggtggtctgg
ttaagacgagaagatgttggtagcagcaaattgccaattgtttactccaaaaagtatgcg
gtccgctttgctggccttgaaaagttgcatccctttgatgcagccaaaggaaaacatata
cataagagactatgcgcagaactcctattgggaaacggtgacttctatgaaccaaaagag
gttaccaaagagcaattgcgccgcatacatactcgaaaatatttaacatcgctggagtgc
agcatgaatgtggcatcaattgctgaggtcccactgctaagtttcgtacccaatacatat
gtccaatcgtgctacttgcgtccgatgcgtttccaaactgccggctccattttggccggc
aagttggccttggaatacggatggtctatcaatttgggaggtggatttcatcattgttgc
acctcgaagggtggcggtttctgcccttatgccgatatatccatgctggtcgttcgactc
tttgagttggaaccgtttcgtgtgcaacgcattatgattgtggacctggatgctcatcag
ggtaatggacatgaacgtgattttcacaatgtggccgctgtttacattctggacatgtac
aatgcatccatctacccaaaggatcatgaggccaaaaccaccatacgatgcgctgtagag
ctacgtccgcgtaccgaggactctttctacttgaagaaattggcccaatgcctaaaaacg
gcagttgctgagtttaaaccgaatgtggtgatctacaatgcaggcaccgatatactcgac
ggcgatccgttgggcaatttggccatcacaccgggcggagttatggaaagagatcgcctt
gtgtttagcacatttcgtgcattgaatataccaattatcatgttgctcagtggtggctac
gtcaagaaatcggcttgtgttatagccgactcgattgttaatctacgacgaaagggtttg
cttaactaa

DBGET integrated database retrieval system