KEGG   Drosophila willistoni: Dwil_GK10886Help
Entry
Dwil_GK10886      CDS       T01067                                 

Definition
GK10886 gene product from transcript GK10886-RA
Orthology
K04437  
filamin
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2561 aa AA seqDB search
MAKRIEKCAVEIMAEKSNGRSGNHDDADGITPNHNTAIARNQHINGAGDLVQNSYTNGQT
SQATIYLNHSNNNNHRGQYNHQQLGNTHLPNNNNSPPNSANACVYNNNNSDQNFSNLSFY
AQQPKASTNTGDVFYHQQPNEYYPQQQLQNQQQLPDQYDENFDEDMEAERDLAEDAQWKK
IQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALVEVLSQKRLPKHNKRPTFRSQKL
ENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLN
GSGPTPKQRLLNWIHTRIPDMPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAV
QNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPN
RVRAYGPGIEPIGPVVGAPANFTVETFSAGKGVVDVEIEGPNGEIEKADVRFNQDKNLTY
TVSYIPKAEGQHKVTVKFSGRDIPKSPFPVKVEGHAGDASKVQVTGPGIHPTGVTIKKPT
FFDILTKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAG
TPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGLPEVRVIGP
GGMNQNVMQSKIDGHTYQCQYYPTKEGRYVVMVTYGGQEVPKSPFEVKVGPKKESSIVAY
GPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEY
AVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTNNQPTSFDVDTSKAGN
APLEVVVQDVYGTKIPVQLKNNPDGTKKVTYTPTTGVPHTVEVNYGGVSTPNSPHRIYVG
VPVDASKVQAFGPWLQPGVRPNVPTHFNVDARDAGEAELKVKVIHEETKIDVPCRIIDNE
DSTYSVEVIPPTKGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPTAPLNSLQQ
FRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPIT
PRPFRLQCLTGSDSNKVHAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAIN
CRDNGDGTCNVAYLPTEAGDYTVNITFNERHIIGSPFQPIIMPVPNLKNTRVSGIGIQPH
GVIMNAATDFMVDMSKVGSNIESGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEA
GRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNG
GLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFAEKHIPGSPFRVVVEETV
DPSKVKVYGPGIEHGQVRESVPTYFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGDC
IYAVHYVPPKAGSVLTCQVKFADVEVPCSPFVMTVFPKSEATKVKVKGVNEKKKTPASLP
AEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVASGTYVVSFVPDECGTYQCSIKYGDK
EIEGSPFKLEAFPTGEAKKCKLVEQAPKILPSGSQSHLKVDAREAGDGAVTCKITNKAGS
EIVGIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYEYVEEHS
TKVIKQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKIDKPVIQDNRDG
TVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANF
TISTKGASAGGLTMAVEGPSKAEINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDRHIKGS
PYFAKITGEGRKRNQISVGSCSEVQMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTG
NIGISFTPREIGEHLVSVKRMGKHINNSPFKVTVCEREVGDAKKVKVSGIGLKEGQTHAD
NIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHV
EGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSN
VTEDAEIQEVEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKA
GGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVSEPG
EYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGD
LDAKIVAPSGTDDDCFIQNIDSEMTSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKD
VADPAAVHATGNGLDDVKTGHKHDFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKV
RYTPLLPGEHYITVKYNNMHIVGSPFKVQATGEKLADEGAQETSTVIVETVRKIAKGGKN
TGVHLPTFKSDSTKVESKGMGLKKAYIGKQNQFTICATDAGNNILYVGMYGPKGPCEELH
VKHAGHNNYNVHYVVRDRGQYVLLIKWGEEHVPGSPFQIDV
NT seq 7686 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgaattgaaaagtgcgccgtcgaaatcatggcagagaaaagtaacggtcga
tcgggcaaccacgacgacgcggacggaataactccaaaccataacaccgcgatcgctaga
aatcaacacattaacggcgcgggtgacttagtgcaaaatagttatacaaacggccaaaca
tcgcaagcgaccatatatcttaaccatagcaataacaataatcacagaggccaatacaac
caccaacaactgggcaacactcacctgcccaataataataatagtccgccaaattccgcc
aacgcgtgtgtttacaacaataacaacagtgatcagaatttcagcaatttaagtttctac
gcacaacaaccaaaggcgtcaacaaacaccggcgacgttttctatcatcaacagcccaac
gaatattatccacagcagcagctccaaaatcaacagcagttgccggatcaatacgacgag
aattttgacgaagacatggaagctgaacgtgatcttgccgaggatgcgcaatggaagaaa
atccaacagaatacctttacacgttgggccaacgagcatctaaagaccatcgatcgttcc
ataaataatttggaaactgatctatccgatggccttagattgattgcccttgttgaggtt
ttgtcgcagaaacgtttgcccaaacataataaacgaccaacattccgtagccagaaattg
gaaaatgtttcagtggccttgaaattcctccaggatgagggcatcaaaattgttaatatt
gattcgtcggacattgtggactgtaagctgaaattgatactgggtctgatatggacactt
attctccactattcgatatcgatgcccatgtgggatggtgaggatgagaagcaattgaat
ggctcgggtccgacacctaaacagcgtctactcaactggatacatactagaatacccgat
atgcccataaataactttactaatgactggactactggcaaggctgtgggtgctttagtt
gatgcctgtgccccgggtctctgtcccgactgggagctctgggatcccaaagatgctgtg
caaaatgcctctgaggccatgggtttggctgatgattggcttaatgtacgccagttgata
aagcccgaggaactggtcaatcccaatgttgacgagcaatccatgatgacctatttgtcg
caatatcccaactcaaagctcaagactggagctcctttgcgtcccaagactaatccaaat
agagtacgtgcctatggacctggaattgaacccattggacctgtggttggggcaccagcc
aacttcaccgtcgaaactttctccgctggcaaaggcgttgtcgatgttgagatcgaagga
ccaaacggagagatcgagaaagctgatgtgcgcttcaatcaagacaagaatctcacatat
accgtctcctatatacccaaggctgagggtcagcataaggtaaccgttaagttttcgggt
cgcgatattccgaaaagtccgttccccgtaaaagttgaaggacatgccggagatgcatct
aaggttcaggtaactggtcctggcattcaccctactggtgtgaccatcaagaaacccacc
ttctttgacatactcaccaaggatgctggacgcggtgttccggaggtgataatcattgat
cctgccaatcataaaacttccgtggcggccaaagtgcgccagttggagaatgatacttgg
cgttgcgaatatgtcaccgctctgcagggcttgcactcggttaatgtgttctatgccggc
acaccaataccgaacagtccgttccccgtgaaggttgccccattgtcagatgctcgcaaa
gtgcgcgcctctggccgtggtcttcaagcaacgggcgttcgggttggagatgatgctgac
tttaagatttacacagagggagccggcgagggtttaccggaggtgcgtgtcattggaccc
ggtggcatgaaccaaaacgttatgcaatcaaagatcgatggtcatacgtatcagtgccag
tattatcccaccaaggagggacgatatgtagtcatggttacttatggaggccaagaagta
cccaaatcacccttcgaggtgaaagttggtcccaagaaggagtcatccattgtggcatat
ggtcctggattgagtagtggtgtcattggatatcccgctgcctttgtagtggagaccaat
ggtgagacaggtgccctcggatttaccgtggctggtccctcgcaagcagagatcgagtgt
catgataacggtgatggctccgctctggtcaagtatcatccaactgcagtgggagaatat
gctgttcacattctatgcgataacgaggatatacccaagtcaccgtttattgctcagata
ttgccgcgcaccgatttccatccggagttggtcaaagccagtggtcctggtctcgaaaag
aatggagttaccaacaatcaacccaccagcttcgatgttgataccagcaaggcaggcaac
gctccattggaggtcgttgttcaggatgtctatggcaccaagattccagtgcagctgaaa
aacaatcccgatggcactaagaaggtcacctacacgccaaccaccggtgtgccacacact
gtggaagtcaactacggcggagtatcaacacccaattctcctcaccgcatctatgtggga
gtgcccgttgatgcatctaaggtccaagcatttggtccatggcttcaacctggtgtacgt
cccaatgtgcccacacatttcaatgtggatgctcgtgatgccggcgaggctgaattaaag
gtgaaggtaatccatgaagaaaccaaaattgatgttccctgccgcatcatcgacaacgag
gacagtacctattcggttgaggttattccacccaccaaaggagcatataccacaaccatg
acatatggcggacaacgtgtgcccctcggccagaaggtggttgtcgagcagacagtggat
gtgtctaagatcaaggtcgatggacttgagccgaccgcgcccctaaacagtttgcagcag
ttccgcatcatcacccatggtctacctaaagcggacttggcagtgactatcacaagtcct
tcgggtaatcggatcaaggcgcacattataccaacagcagagggttttcttgttaacttt
acgcccacccagttgggagagtatttgctgagcatttgttttggcggcacacccattacg
ccgcgtcccttccgcctgcaatgtctgactggcagtgattctaacaaagtccatgccttt
gggcctggactagagcgcggtattgtgggtcagccggcagagtttatgatcgatacgaga
ggtgccggccaaggtggcttgggcgtcacagttgaagggccctgcgaggcggccatcaat
tgccgcgacaatggtgatggcacctgcaatgtggcctatctgcccaccgaagctggcgat
tatacagtcaatataacgttcaatgagcgccacatcattggctcaccattccagcccatc
attatgccagtgccgaatctgaagaacacacgagtcagcggcattggcatacagccccac
ggtgttatcatgaatgctgcaactgattttatggtagacatgagcaaggtgggcagcaac
attgagtcgggaaaattatcctgtgccatttttgatccaatgggtcatgtgctgcctagc
aagattgttcaaggacctactgatgacattttccgcattatgtatactccatttgaggct
ggacgacacaccattgagcttatgtatgacaatatacccgttccgggatcgccatttgtg
gtgaatgttaagagcggctgtgatccagcacgctgcaaggcctacggaccaggtctggag
aagggtctaaccaatcagaagaacaaattcaccgtcgagaccaaaggtgctggtaatggc
ggtctctcgttggccatcgaaggcccatcggaggctaaaatgacctgcacggataatcgc
gatggcagctgtgatgttgactatttggccacagatccgggagagtatgatataaccatt
cgctttgcggagaagcatatacccggctctcccttccgagtggtcgtggaagagactgtc
gatcccagcaaggtgaaggtctatggtccaggcatcgagcatggacaggtgcgcgaaagt
gtgcctacctatttcaatgtagatgtaggcgaggctggtcctggccgcattgccgttaaa
ttgaccaattcagagggcatacctgtggataatctgcgtgtggaggacaagggtgattgt
atttatgccgtgcactatgtgccacccaaagctggttcagtgctaacctgccaagtgaaa
tttgccgatgttgaagtgccatgcagtccattcgtgatgacagtcttccccaaatccgag
gccactaaggtcaaggtcaagggtgtaaatgagaaaaagaagacaccagcttcactacca
gccgaatttgaaattgataccaaacaagcgggtcaggctgacatcaatgtggccatcaag
aatccaaagggcaaagccatgcagccgcgcctcgaagaagtggccagcgggacttatgtg
gtatcctttgtgcccgatgagtgcggcacatatcagtgcagcattaaatatggtgacaag
gagattgagggctctcccttcaaactcgaagcattccccaccggcgaggccaagaaatgt
aagctagttgagcaggcacccaaaattctaccgtcgggcagtcaatcccatctcaaagtg
gatgcacgtgaggcgggcgatggtgcagtaacctgcaagatcaccaacaaggctggcagc
gaaattgtgggcattgatgtgattgagaaggatggattcttcgacatactttatgctcta
aatgaccctggcgactatgacatcaatgttaaattcggtggcaaggatataccgaatggt
agcttctccattaaggctgtcgaaagcatcgaacaatacgaatacgtcgaagagcattca
accaaggtgattaagcaaacaactcagagcgaacttgttaacggaaagagtgaaatcaca
tatcgtagtgttgcctttgagaaattgccactccccacaacaggcggtaacgttacagct
gaagtcagaatgccaagcggtaagatagacaaaccagttattcaggacaatcgtgatggt
accgtctcggtgaagtacgatccacgcgaggagggctctcacgagttggtggttaaatac
aacggtgaacccgtccagggatcacccttcaaattccatgtggattccatcacctcgggc
tatgtgacagcctatggaccaggtttgacgcatggcgtcactggtgaaccagccaatttc
accatctcaaccaagggagccagcgccggaggcctgaccatggccgttgagggtcccagc
aaggctgagatcaactaccatgacaacaaggacggaaccgtgtcggtacaatatctgcca
acggcacctggtgaatatcaggtttcggtgcgtttcggtgataggcacattaagggctcc
ccgtactttgccaagatcactggcgagggtcgtaagcgtaatcagatttctgtgggctcc
tgctctgaggtgcaaatgcccggtgacattacggatgatgatctccgtgctctcaatgcc
tccattcaggcacccagcggtttggaggagccatgcttcctgaagcgtatgcccactggc
aacattggcatttcattcactccccgtgagattggcgagcatttggtgtcggttaagcgt
atgggcaagcacatcaacaactcccccttcaaggtcaccgtctgcgaacgcgaagtgggc
gatgccaagaaggttaaggtatctggaatcggacttaaggagggccagacccatgccgat
aacatcttctcggtggatacccgtaatgccggattcggtggtctctccgtttccattgag
ggtcccagcaaggcggaaatccagtgtaccgataaggacgatggcactctgaacatctcc
tacaagcccaccgaaccgggttactacattgtcaatttgaagttcgctgatcaccatgtc
gaaggatcgcccttcacagtgaaagtagccggcgagggaagcaatcgcaagcgcgagaag
attcagcgtgagcgcgatgccgtgcccattacggagattggcagccagtgcaagttgacc
ttcaagatgccaggcatcacatccttcgatttggccgcctgtgtgacgtcgccaagcaat
gtgactgaagatgctgagattcaggaagtcgaggatggcctctactcggtgcactttgtg
cccaaagaactgggcgtgcacactgtttccgtgcgttactctgagatgcatattcccggc
tcacccttccagttcaccgtgggtccactgcgtgactctggcagccatttggtgaaggct
ggcggctctggtctggagcgcggcgtggtcggtgaggcagctgagttcaatgtatggaca
cgcgaggctggcggcggttcattggccatttccgtggaaggccccagcaaggctgacatt
gagttcaaggatcgcaaggacggcagctgcgatgtgtcctacaaggtctccgaaccagga
gagtaccgtgtgggcctcaaattcaatgaccgtcacatacccgactcgccattcaaggtc
tacgtctctccggatgccggtgatgctcataaactggaagtacagcaattcccccagggc
aacatccaggccgatgctccgtatcagttcatggtgcgcaagaatggagctaagggcgat
ttggatgccaaaatcgtggccccctcaggaaccgatgacgattgcttcattcaaaatatc
gacagtgagatgacctcggttcgtttctatccacgtgagaacggcattcatgccattcat
gtcaagttcaacggcgtccatattcccgactcgccattcagaatcaaggtcggcaaggat
gtggccgacccagccgctgtgcatgccaccggcaatggcctcgatgatgtcaagacgggc
cacaagcatgattttatcatcaatacctgcaatgctggtgtcggcacactcgctgtctcc
atcgatggcccatccaaggtggccatggattgcactgaggtcgaggagggctacaaggtg
cgctacactcccctgttgcctggagagcactacattacggttaagtacaacaacatgcac
attgtgggatcgccattcaaggtgcaagccaccggagaaaagctggccgatgagggtgcc
caggagacatccacagtgattgtggagactgtgcggaagatcgccaagggaggcaaaaat
accggagtacatctgcctactttcaaatccgattccaccaaggtggagtccaagggcatg
ggtctaaagaaggcctacattggcaagcaaaatcagtttaccatctgtgccaccgatgca
ggcaacaacatcctgtacgttggcatgtatggaccaaagggaccctgcgaggagctccat
gtcaagcatgctggccacaacaactacaatgttcattatgtggtacgcgatcgcggccaa
tacgtgctccttatcaaatggggcgaagagcatgtacccggctccccattccagatcgat
gtctag

DBGET integrated database retrieval system