KEGG   Drosophila willistoni: Dwil_GK10886Help
Entry
Dwil_GK10886      CDS       T01067                                 

Definition
(RefSeq) GK10886 gene product from transcript GK10886-RB
  KO
K04437  
filamin
Organism
dwi  Drosophila willistoni
Brite
Cytoskeleton proteins [BR:dwi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dwil_GK10886
  Intermediate filaments
   Intermediate filament-binding proteins
    Dwil_GK10886
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dwil_GK10886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2396 aa AA seqDB search
MEAERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALVEVLSQKR
LPKHNKRPTFRSQKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYS
ISMPMWDGEDEKQLNGSGPTPKQRLLNWIHTRIPDMPINNFTNDWTTGKAVGALVDACAP
GLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNS
KLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGVVDVEIEGPNGEI
EKADVRFNQDKNLTYTVSYIPKAEGQHKVTVKFSGRDIPKSPFPVKVEGHAGDASKVQVT
GPGIHPTGVTIKKPTFFDILTKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYV
TALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYT
EGAGEGLPEVRVIGPGGMNQNVMQSKIDGHTYQCQYYPTKEGRYVVMVTYGGQEVPKSPF
EVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGD
GSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTN
NQPTSFDVDTSKAGNAPLEVVVQDVYGTKIPVQLKNNPDGTKKVTYTPTTGVPHTVEVNY
GGVSTPNSPHRIYVGVPVDASKVQAFGPWLQPGVRPNVPTHFNVDARDAGEAELKVKVIH
EETKIDVPCRIIDNEDSTYSVEVIPPTKGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIK
VDGLEPTAPLNSLQQFRIITHGLPKADLAVTITSPSGNRIKAHIIPTAEGFLVNFTPTQL
GEYLLSICFGGTPITPRPFRLQCLTGSDSNKVHAFGPGLERGIVGQPAEFMIDTRGAGQG
GLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHIIGSPFQPIIMPVP
NLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIESGKLSCAIFDPMGHVLPSKIVQG
PTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTN
QKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFAEK
HIPGSPFRVVVEETVDPSKVKVYGPGIEHGQVRESVPTYFNVDVGEAGPGRIAVKLTNSE
GIPVDNLRVEDKGDCIYAVHYVPPKAGSVLTCQVKFADVEVPCSPFVMTVFPKSEATKVK
VKGVNEKKKTPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVASGTYVVSFVP
DECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKILPSGSQSHLKVDAREA
GDGAVTCKITNKAGSEIVGIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIK
AVESIEQYEYVEEHSTKVIKQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMP
SGKIDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAY
GPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKAEINYHDNKDGTVSVQYLPTAPGE
YQVSVRFGDRHIKGSPYFAKITGEGRKRNQISVGSCSEVQMPGDITDDDLRALNASIQAP
SGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRMGKHINNSPFKVTVCEREVGDAKKV
KVSGIGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTE
PGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPG
ITSFDLAACVTSPSNVTEDAEIQEVEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQF
TVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDR
KDGSCDVSYKVSEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQAD
APYQFMVRKNGAKGDLDAKIVAPSGTDDDCFIQNIDSEMTSVRFYPRENGIHAIHVKFNG
VHIPDSPFRIKVGKDVADPAAVHATGNGLDDVKTGHKHDFIINTCNAGVGTLAVSIDGPS
KVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVQATGEKLADEGAQETST
VIVETVRKIAKGGKNTGVHLPTFKSDSTKVESKGMGLKKAYIGKQNQFTICATDAGNNIL
YVGMYGPKGPCEELHVKHAGHNNYNVHYVVRDRGQYVLLIKWGEEHVPGSPFQIDV
NT seq 7191 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgaacgtgatcttgccgaggatgcgcaatggaagaaaatccaacagaatacc
tttacacgttgggccaacgagcatctaaagaccatcgatcgttccataaataatttggaa
actgatctatccgatggccttagattgattgcccttgttgaggttttgtcgcagaaacgt
ttgcccaaacataataaacgaccaacattccgtagccagaaattggaaaatgtttcagtg
gccttgaaattcctccaggatgagggcatcaaaattgttaatattgattcgtcggacatt
gtggactgtaagctgaaattgatactgggtctgatatggacacttattctccactattcg
atatcgatgcccatgtgggatggtgaggatgagaagcaattgaatggctcgggtccgaca
cctaaacagcgtctactcaactggatacatactagaatacccgatatgcccataaataac
tttactaatgactggactactggcaaggctgtgggtgctttagttgatgcctgtgccccg
ggtctctgtcccgactgggagctctgggatcccaaagatgctgtgcaaaatgcctctgag
gccatgggtttggctgatgattggcttaatgtacgccagttgataaagcccgaggaactg
gtcaatcccaatgttgacgagcaatccatgatgacctatttgtcgcaatatcccaactca
aagctcaagactggagctcctttgcgtcccaagactaatccaaatagagtacgtgcctat
ggacctggaattgaacccattggacctgtggttggggcaccagccaacttcaccgtcgaa
actttctccgctggcaaaggcgttgtcgatgttgagatcgaaggaccaaacggagagatc
gagaaagctgatgtgcgcttcaatcaagacaagaatctcacatataccgtctcctatata
cccaaggctgagggtcagcataaggtaaccgttaagttttcgggtcgcgatattccgaaa
agtccgttccccgtaaaagttgaaggacatgccggagatgcatctaaggttcaggtaact
ggtcctggcattcaccctactggtgtgaccatcaagaaacccaccttctttgacatactc
accaaggatgctggacgcggtgttccggaggtgataatcattgatcctgccaatcataaa
acttccgtggcggccaaagtgcgccagttggagaatgatacttggcgttgcgaatatgtc
accgctctgcagggcttgcactcggttaatgtgttctatgccggcacaccaataccgaac
agtccgttccccgtgaaggttgccccattgtcagatgctcgcaaagtgcgcgcctctggc
cgtggtcttcaagcaacgggcgttcgggttggagatgatgctgactttaagatttacaca
gagggagccggcgagggtttaccggaggtgcgtgtcattggacccggtggcatgaaccaa
aacgttatgcaatcaaagatcgatggtcatacgtatcagtgccagtattatcccaccaag
gagggacgatatgtagtcatggttacttatggaggccaagaagtacccaaatcacccttc
gaggtgaaagttggtcccaagaaggagtcatccattgtggcatatggtcctggattgagt
agtggtgtcattggatatcccgctgcctttgtagtggagaccaatggtgagacaggtgcc
ctcggatttaccgtggctggtccctcgcaagcagagatcgagtgtcatgataacggtgat
ggctccgctctggtcaagtatcatccaactgcagtgggagaatatgctgttcacattcta
tgcgataacgaggatatacccaagtcaccgtttattgctcagatattgccgcgcaccgat
ttccatccggagttggtcaaagccagtggtcctggtctcgaaaagaatggagttaccaac
aatcaacccaccagcttcgatgttgataccagcaaggcaggcaacgctccattggaggtc
gttgttcaggatgtctatggcaccaagattccagtgcagctgaaaaacaatcccgatggc
actaagaaggtcacctacacgccaaccaccggtgtgccacacactgtggaagtcaactac
ggcggagtatcaacacccaattctcctcaccgcatctatgtgggagtgcccgttgatgca
tctaaggtccaagcatttggtccatggcttcaacctggtgtacgtcccaatgtgcccaca
catttcaatgtggatgctcgtgatgccggcgaggctgaattaaaggtgaaggtaatccat
gaagaaaccaaaattgatgttccctgccgcatcatcgacaacgaggacagtacctattcg
gttgaggttattccacccaccaaaggagcatataccacaaccatgacatatggcggacaa
cgtgtgcccctcggccagaaggtggttgtcgagcagacagtggatgtgtctaagatcaag
gtcgatggacttgagccgaccgcgcccctaaacagtttgcagcagttccgcatcatcacc
catggtctacctaaagcggacttggcagtgactatcacaagtccttcgggtaatcggatc
aaggcgcacattataccaacagcagagggttttcttgttaactttacgcccacccagttg
ggagagtatttgctgagcatttgttttggcggcacacccattacgccgcgtcccttccgc
ctgcaatgtctgactggcagtgattctaacaaagtccatgcctttgggcctggactagag
cgcggtattgtgggtcagccggcagagtttatgatcgatacgagaggtgccggccaaggt
ggcttgggcgtcacagttgaagggccctgcgaggcggccatcaattgccgcgacaatggt
gatggcacctgcaatgtggcctatctgcccaccgaagctggcgattatacagtcaatata
acgttcaatgagcgccacatcattggctcaccattccagcccatcattatgccagtgccg
aatctgaagaacacacgagtcagcggcattggcatacagccccacggtgttatcatgaat
gctgcaactgattttatggtagacatgagcaaggtgggcagcaacattgagtcgggaaaa
ttatcctgtgccatttttgatccaatgggtcatgtgctgcctagcaagattgttcaagga
cctactgatgacattttccgcattatgtatactccatttgaggctggacgacacaccatt
gagcttatgtatgacaatatacccgttccgggatcgccatttgtggtgaatgttaagagc
ggctgtgatccagcacgctgcaaggcctacggaccaggtctggagaagggtctaaccaat
cagaagaacaaattcaccgtcgagaccaaaggtgctggtaatggcggtctctcgttggcc
atcgaaggcccatcggaggctaaaatgacctgcacggataatcgcgatggcagctgtgat
gttgactatttggccacagatccgggagagtatgatataaccattcgctttgcggagaag
catatacccggctctcccttccgagtggtcgtggaagagactgtcgatcccagcaaggtg
aaggtctatggtccaggcatcgagcatggacaggtgcgcgaaagtgtgcctacctatttc
aatgtagatgtaggcgaggctggtcctggccgcattgccgttaaattgaccaattcagag
ggcatacctgtggataatctgcgtgtggaggacaagggtgattgtatttatgccgtgcac
tatgtgccacccaaagctggttcagtgctaacctgccaagtgaaatttgccgatgttgaa
gtgccatgcagtccattcgtgatgacagtcttccccaaatccgaggccactaaggtcaag
gtcaagggtgtaaatgagaaaaagaagacaccagcttcactaccagccgaatttgaaatt
gataccaaacaagcgggtcaggctgacatcaatgtggccatcaagaatccaaagggcaaa
gccatgcagccgcgcctcgaagaagtggccagcgggacttatgtggtatcctttgtgccc
gatgagtgcggcacatatcagtgcagcattaaatatggtgacaaggagattgagggctct
cccttcaaactcgaagcattccccaccggcgaggccaagaaatgtaagctagttgagcag
gcacccaaaattctaccgtcgggcagtcaatcccatctcaaagtggatgcacgtgaggcg
ggcgatggtgcagtaacctgcaagatcaccaacaaggctggcagcgaaattgtgggcatt
gatgtgattgagaaggatggattcttcgacatactttatgctctaaatgaccctggcgac
tatgacatcaatgttaaattcggtggcaaggatataccgaatggtagcttctccattaag
gctgtcgaaagcatcgaacaatacgaatacgtcgaagagcattcaaccaaggtgattaag
caaacaactcagagcgaacttgttaacggaaagagtgaaatcacatatcgtagtgttgcc
tttgagaaattgccactccccacaacaggcggtaacgttacagctgaagtcagaatgcca
agcggtaagatagacaaaccagttattcaggacaatcgtgatggtaccgtctcggtgaag
tacgatccacgcgaggagggctctcacgagttggtggttaaatacaacggtgaacccgtc
cagggatcacccttcaaattccatgtggattccatcacctcgggctatgtgacagcctat
ggaccaggtttgacgcatggcgtcactggtgaaccagccaatttcaccatctcaaccaag
ggagccagcgccggaggcctgaccatggccgttgagggtcccagcaaggctgagatcaac
taccatgacaacaaggacggaaccgtgtcggtacaatatctgccaacggcacctggtgaa
tatcaggtttcggtgcgtttcggtgataggcacattaagggctccccgtactttgccaag
atcactggcgagggtcgtaagcgtaatcagatttctgtgggctcctgctctgaggtgcaa
atgcccggtgacattacggatgatgatctccgtgctctcaatgcctccattcaggcaccc
agcggtttggaggagccatgcttcctgaagcgtatgcccactggcaacattggcatttca
ttcactccccgtgagattggcgagcatttggtgtcggttaagcgtatgggcaagcacatc
aacaactcccccttcaaggtcaccgtctgcgaacgcgaagtgggcgatgccaagaaggtt
aaggtatctggaatcggacttaaggagggccagacccatgccgataacatcttctcggtg
gatacccgtaatgccggattcggtggtctctccgtttccattgagggtcccagcaaggcg
gaaatccagtgtaccgataaggacgatggcactctgaacatctcctacaagcccaccgaa
ccgggttactacattgtcaatttgaagttcgctgatcaccatgtcgaaggatcgcccttc
acagtgaaagtagccggcgagggaagcaatcgcaagcgcgagaagattcagcgtgagcgc
gatgccgtgcccattacggagattggcagccagtgcaagttgaccttcaagatgccaggc
atcacatccttcgatttggccgcctgtgtgacgtcgccaagcaatgtgactgaagatgct
gagattcaggaagtcgaggatggcctctactcggtgcactttgtgcccaaagaactgggc
gtgcacactgtttccgtgcgttactctgagatgcatattcccggctcacccttccagttc
accgtgggtccactgcgtgactctggcagccatttggtgaaggctggcggctctggtctg
gagcgcggcgtggtcggtgaggcagctgagttcaatgtatggacacgcgaggctggcggc
ggttcattggccatttccgtggaaggccccagcaaggctgacattgagttcaaggatcgc
aaggacggcagctgcgatgtgtcctacaaggtctccgaaccaggagagtaccgtgtgggc
ctcaaattcaatgaccgtcacatacccgactcgccattcaaggtctacgtctctccggat
gccggtgatgctcataaactggaagtacagcaattcccccagggcaacatccaggccgat
gctccgtatcagttcatggtgcgcaagaatggagctaagggcgatttggatgccaaaatc
gtggccccctcaggaaccgatgacgattgcttcattcaaaatatcgacagtgagatgacc
tcggttcgtttctatccacgtgagaacggcattcatgccattcatgtcaagttcaacggc
gtccatattcccgactcgccattcagaatcaaggtcggcaaggatgtggccgacccagcc
gctgtgcatgccaccggcaatggcctcgatgatgtcaagacgggccacaagcatgatttt
atcatcaatacctgcaatgctggtgtcggcacactcgctgtctccatcgatggcccatcc
aaggtggccatggattgcactgaggtcgaggagggctacaaggtgcgctacactcccctg
ttgcctggagagcactacattacggttaagtacaacaacatgcacattgtgggatcgcca
ttcaaggtgcaagccaccggagaaaagctggccgatgagggtgcccaggagacatccaca
gtgattgtggagactgtgcggaagatcgccaagggaggcaaaaataccggagtacatctg
cctactttcaaatccgattccaccaaggtggagtccaagggcatgggtctaaagaaggcc
tacattggcaagcaaaatcagtttaccatctgtgccaccgatgcaggcaacaacatcctg
tacgttggcatgtatggaccaaagggaccctgcgaggagctccatgtcaagcatgctggc
cacaacaactacaatgttcattatgtggtacgcgatcgcggccaatacgtgctccttatc
aaatggggcgaagagcatgtacccggctccccattccagatcgatgtctag

DBGET integrated database retrieval system