KEGG   Drosophila willistoni: Dwil_GK10916Help
Entry
Dwil_GK10916      CDS       T01067                                 

Definition
GK10916 gene product from transcript GK10916-RA
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1009 aa AA seqDB search
MEDAANRQLASQQDEQRQFICGVIEGFYGRPWTTEQRKDLFRKLKKLGMDSYMYAPKDDY
KHRAYWRELYTVEEADHLSGLIAAAKEAGIVFYYALSPGLDMTYSSQKEIATLKRKLDQV
SQFGCEAYALLFDDIESELCKSDKEVFQTFGNAQVSVTNEIYLHLGGPKFLFCPTQYCVT
RAVPTIQESEYLNTLGSKLNNEIDILWTGDKVISKTITIESIQEITEVLRRPPVIWDNLH
ANDYDQKRVFLGPYTGRSPALIPHLRGVMTNPNCEFFANFIAIHSLAFWSRCNMDSKMNS
SLSADIKLETENEDEVPVEFLSKNVYHPRLALKNALNEWLPEFFVEREAWGPITKPQPQV
QMVMPIIPIIPSINTCMSLTTTTTTTSTSTRTVPEVNTTQLQALADVCSTVSSAMTPICN
PVMNSLVSPTKVITNEEIINPIPTTAASNIELPKKIPISIVPVPIMEAKNVDPTLEDSLD
SEEAKQEDIAIEDEKTRDLEPVTSSLSVDTMLDDNSLSPLSAGINEPMECSSSLASQVSP
KEEQQLQTPKLIADDVLMESVNDVHIMHVESSASSSLSNAEMREDEQIIKNDEPTPVGSK
INLEDLSLLSDLFYLPFEHGSRGLKLLSEFNWLKSNANVLLQASGDANKEWLQRCGAYDN
LCASVQELLMKIAGCENKEICHELYSYVWDISGALSLLNGYVKWLALGQFPQNMASYTEG
SYTWFSKGWKEAFMSGDQEPWVFRGGLIADLQRLMPVDSANDLFIYKLPEQPTSNYYLLR
PYCSTDEQEVNDVCTRSYLECSPNLHDDDDDADNEQIPALPTNVINIVADAIVGAHLTLD
SKFCIVAYDGNESIVGYACASLDVNLYHRNWELCWLPELREKYPKSLIDPEDDANLVGNG
KLQQLIHSFVDKFHNSTEPLEICPPAEVTSSFPAVMCAATTKEADQQDNGIAKRMLTVLL
AALRANGCFGVHVCVPEHNVDQVNFYTKIGFVDVYREESRHCIYLGRRF
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgccgccaatcgacagctagcgtctcagcaggatgagcaacggcagttcatt
tgcggtgttattgagggcttctacggccgaccatggacaaccgaacagcgcaaagatttg
tttcgcaaactcaagaagctgggcatggactcttatatgtatgcacccaaggacgattac
aagcacagggcatactggcgtgaattatatacagtagaggaagctgatcatttatcaggt
ttaattgctgctgccaaggaagccggcattgtgttctactacgccctgtcgccgggcctg
gacatgacatacagcagccagaaagagatagcgaccttaaaacggaagctagatcaggta
tcacaattcggatgcgaagcctatgccctactcttcgatgacattgaatcggagctgtgc
aagtctgacaaagaggtctttcagacctttggcaatgctcaggtgtcggtgacaaacgaa
atttaccttcacttgggcggacccaaatttctattttgccctacccagtattgcgtcacc
cgtgccgtgcctaccatccaagaatcggagtatttaaatacattgggctccaagctaaac
aatgaaatcgatattctatggacgggggataaggtgatctcgaaaacgattaccattgaa
tctatacaggaaatcactgaagttctacgtcgaccgcctgttatttgggataatcttcat
gccaatgattatgatcagaagcgagtgtttctgggaccctatactggtcgatcgccagct
ttaataccacatcttcgcggggttatgacgaatcccaattgtgaattcttcgccaacttt
attgcgattcattcattggcattttggtcacgctgcaatatggattccaagatgaatagc
tcgctgagtgccgatattaaattagagactgaaaatgaggatgaggtccccgtggaattt
ctatcaaagaatgtatatcatccacgtttggccttaaagaatgcccttaacgaatggctg
cccgaattctttgtggaacgagaagcctggggacccataactaagccgcaaccgcaagta
caaatggttatgccaatcataccaattataccatccattaacacttgcatgagtctgaca
acaaccaccacgaccacttcaacgagcacgaggacagtgccagaggtgaataccactcaa
ttgcaggctctggccgatgtctgtagcactgttagctcggctatgacgcccatatgcaat
ccggtgatgaattccctggtctcgcccaccaaagtcataaccaacgaggaaattatcaat
cctatacctactacagccgctagcaacattgagttgcccaagaagataccgatttctatt
gttccggtccccataatggaggcgaaaaatgttgatcctacgttggaggatagtctggat
agcgaggaagctaagcaagaggatattgccattgaggatgaaaaaaccagagatttagaa
cccgtaacttcaagtcttagtgtggacacaatgctagatgacaacagcttgagtccctta
agcgccggcatcaatgaacccatggaatgcagcagcagtctagcatcgcaagtatctcca
aaagaggagcagcagctacaaacacctaaattgattgccgacgatgttcttatggaatcg
gtcaacgatgtacatatcatgcatgtagaaagctcggcctcgtcctcattatcaaatgcc
gaaatgcgagaggatgaacaaatcattaaaaatgatgagcctactcctgttggatccaag
ataaatctggaggacttaagcctgctctctgatcttttctatctgccttttgaacatggc
agtcgtggcttaaagctccttagtgagttcaactggctaaaaagcaatgccaatgtcctg
ctccaggccagcggtgatgccaacaaggaatggctgcaacgatgtggagcttatgataat
ctttgcgcttctgtgcaagaattgttaatgaaaattgccggctgcgaaaataaggaaatc
tgccatgagttgtattcctatgtgtgggacatttcgggtgccctctcactcctgaatggc
tatgtcaaatggttagctttaggacagtttcctcaaaatatggcttcgtatactgaaggc
agctacacctggtttagcaaaggatggaaagaagcttttatgtctggggatcaggagcca
tgggtttttcgtggcggacttattgccgatttgcagcgtctgatgcctgtagattcggcc
aatgatctgtttatctacaaattacccgaacaacctacgtccaattattatcttctaagg
ccttattgcagtacggatgagcaggaagtgaatgatgtttgtactcgatcatatctggag
tgcagtcccaatctgcatgatgatgatgatgatgctgataatgagcagatacctgcgcta
ccgaccaatgtaatcaatattgtggcggatgccattgtgggcgcccatttgacgctggac
tcgaaattttgcattgtggcctatgatgggaatgaaagcattgtgggttatgcctgtgct
tccttggatgtcaatttataccatcgaaactgggagttatgctggctaccggaacttcgt
gaaaaatatccgaaatctcttatcgatccggaggatgatgcaaatttagtgggtaatggc
aaattgcagcagctcattcatagttttgtggataaattccataatagcacagaaccgctg
gaaatatgtccacctgccgaggtaaccagctcctttccggccgtaatgtgtgcagccacc
acaaaagaagcagatcagcaggacaatggcattgccaagcgtatgctgacagtccttttg
gcggcattgcgtgccaatggctgctttggggtgcatgtatgtgtacctgaacacaatgtg
gatcaggtcaatttctatacaaaaattggctttgtcgatgtgtatcgtgaagagagcaga
cattgcatttatttggggcgacgtttctag

DBGET integrated database retrieval system