KEGG   Drosophila willistoni: Dwil_GK10963Help
Entry
Dwil_GK10963      CDS       T01067                                 

Definition
GK10963 gene product from transcript GK10963-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dwi  Drosophila willistoni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dwi00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 547 aa AA seqDB search
MMMLSYLILVGLLALVVVVNGNVWPTRDAERAMHPVFSLTDGSRHKRAMPLINFDAYKTE
ENYAEYWETMAHQTLEQQLESKMRVNTQMAKNVMLFLGDGMSIPTITAGRVYLGGEEKQF
SFEQFPYVGLSKTYCANMQVADSACTATAYLGGIKANYGTVGVSAAVHNKDCQAQADRSH
HVASIAAWAQQQGMATGFVTTTSVTHASPAGVYAHIAHRNWENDAEIISDNGDPTICPDI
AYQLIHGQVGQKLNVIMGGGRENFLPQITRDRSGAPGKRADGRNLIEEWQRQHTNSAHFV
QTRSELLKLSNRTSRVLGLFAPYHMPYHLDSLEADAEQPTLEEMVQMAMNILERQSAGRG
YFLFVEGGRIDHGHHDTLALRAIDETAEFDKSVKWARTHSSTEDTLIVVTADHSHTMSLA
GYSSRKNDIFGINNGQLADDDLPYATLSYANGPGYASNYLREGGAVKRKNLRSINMKNKD
FMFPSTVPLESETHGGDDVAVFASGPYSQLFTGVYEQHFIPHAMGYASCLSDKRNMCLDS
GVTRRPK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgctgtcatacctgatattagttggtctgctggctctggttgttgttgtcaac
gggaatgtttggcccactcgagatgctgagcgtgcaatgcatccagtattctccctgacc
gatggttcacgccataaacgtgccatgcctctgatcaactttgatgcctacaaaaccgag
gagaactatgccgagtattgggagacaatggcccatcaaacgctggaacagcagcttgag
agcaaaatgcgtgtaaatacccaaatggccaagaatgtgatgctctttttgggcgacggc
atgtctataccgactataacagccgggcgtgtgtatttgggaggcgaggagaagcaattc
tcgttcgagcaattcccctatgtgggtctaagtaagacctattgtgcaaatatgcaggtg
gcggactcagcgtgcactgccactgcctatctcggcggcattaaggctaactacggaact
gtaggagtcagtgcggctgttcacaataaagattgccaggcccaagctgatcgctcgcat
catgtggcctcaatagcagcgtgggctcagcagcagggaatggccacgggctttgtgact
accacctcagtgacacatgcatcaccggccggggtttatgcccatatagcccatcggaat
tgggagaacgatgcagaaattataagcgataatggtgatccgaccatctgtcctgatata
gcctatcagctgattcacgggcaagtgggacaaaagctaaatgtgataatgggtggagga
cgggagaattttttgccccaaataacacgagatcggagtggagcacccggcaagcgtgcg
gatggaagaaatctcatcgaggaatggcaacgtcagcataccaacagtgcacactttgtg
cagacgagaagtgaactgctaaagctatcaaatcggaccagccgagtattgggcttattc
gccccctaccatatgccctaccatctcgattcgttggaggcagatgccgagcaacccacc
ttggaggaaatggtccaaatggcaatgaatatactggaacgtcagagtgctggccgtggt
tattttctctttgttgagggcggacgcattgatcatggccatcatgatactttggccctg
cgagctatcgacgagacggctgaattcgacaagtcagtgaaatgggcccgtacgcacagc
agcacagaggacactttaattgtcgttacggctgatcattcccataccatgtctctggct
ggctactctagtcgcaagaacgatatctttggcatcaacaatggccaattggcagacgat
gatctgccctatgctacgctcagctatgccaatggtcccggctatgccagcaactatttg
cgtgagggaggagccgtaaaacgaaagaatctacgctcgattaacatgaagaacaaggac
tttatgtttcccagcacagtgcccctggagtcggagactcatggtggcgacgatgtggcc
gtctttgccagtggaccgtattctcagctgtttacgggcgtctacgagcagcatttcatt
ccacatgcaatgggctatgcctcgtgtctcagcgataagcggaatatgtgcttagacagt
ggagtgacgcggcgaccgaaatga

DBGET integrated database retrieval system