KEGG   Drosophila willistoni: Dwil_GK11091Help
Entry
Dwil_GK11091      CDS       T01067                                 

Definition
(RefSeq) GK11091 gene product from transcript GK11091-RB
  KO
K14316  
nuclear pore complex protein Nup121
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dwil_GK11091
Messenger RNA biogenesis [BR:dwi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dwil_GK11091
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1140 aa AA seqDB search
MERESCCSLSLGAMTPRKGLANPMADSTRIDGGLTSTTSLTPKLNRLYSLRGNDRDSEGR
GRSLSQNQRSNSYSTLSMGSPTKSAYDFNRSTTSSIMNRSKLNLSQLDPRTYANVNSTGL
ASRIAKYQESAAGAGRLQRSISVNNLPMPLVQPRRSIALPTAYSPGAPKLCATRIAPPER
SFYSGNTLSSLLRSNSIVGVVHKSGEQHQGQEQLSRENRPILHPPPTQQEIEPTRSVLEE
LKEISRKRINNGEPHEPPHEFAKKRMAEFVDPHSHVLQAPGLSPHQIPASFKRQREQPLP
LTVAVPLRQPHNTPSPVAMHHHHLQSNGVSGGGSISKLGTPTQLSPEQQAAKRRNCSYSN
DIASSLSSSRRQSHKRKLYDMRVNQRQSITGHELSALGASCNSSPETSPSLQASKIQRKV
EMESVCKTLSMPTPTTTAVAVPVARMQSAPTETDGMRHATPPIAQATKPKLTLFNAQQKN
QSNQEQSSSDLNSPEVDASEYAGIQFVKPKQQNSKSIGIGKNPSIERMQKTKLAIMLSGL
RGEMYIGESEDDTDAALSTSSKLISPIKPIIAATTTITATTMTTATTTTAATATQTSERI
LTKPNVEFKLQPSNSSSNNSSSTIAQANSSSSGFGGFSFGGNAAAPTTTPSLGGFGNQPN
SFLTNSKQPEAHPAASNTATTTPAFGSQTTTSSTSFANAFKPASEANPNPASQETTKAFS
FGSTANKPAAAVVQPTTTASTSNIFGQNLFGQKPAEAATTTTTSTPFAFGGGAKPVAPTA
APTAAPTAAASTPFTFGGAAKPAAPEASASGSFSFGGLKPAAAPAATTGTEKSTPFAFGG
AKPAASGSNLFSFGGAAAAARAPNATTLTGGGAASSSSTTNSAFSFSANAVQKPAASVFG
SQKPSTTATATPFSFGGAAAVEQQQQQQQSNPEAVAPSASGFSFGAAINKTNGDTNAASN
IFGTQTGVVKPSFAFGNNSASTTSTNAAPAQSSGFGGFGAAAAAGGATNQQSKPFSFGGN
SSASVAPAAAAIGGNLFANAVAAAQFGAANNLPSTAPNNSATAKPFNFGGAQTATNNLFS
PSTQTAATVPKPAAAAFQFGAPAPASPAMPTTAQQINANNLFAPPTESRPIRRATRRLQK
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggaaagttgctgcagtttgagtttaggcgctatgacgccccgcaaaggtttg
gctaatcccatggccgattccacacgtattgatggaggattaacatcaacaactagtcta
acacccaaactaaaccgtctttattctctgcgtggcaatgatcgcgatagcgagggaagg
ggacggagtcttagtcaaaaccagcgaagtaactcatactccaccctaagcatgggttca
cccaccaaaagtgcatatgatttcaatcgcagtacaacatcatcgatcatgaatcgatcg
aaattgaatctcagccaattggatcccaggacctatgctaatgttaacagcactggactc
gcttctcgcattgcgaaataccaagaaagtgctgcaggagcaggacgtctacagcgtagc
atatctgtgaacaatttgccaatgccccttgtccaaccaagaagatcaatagccttgccg
actgcctacagtcccggtgcgccgaagttgtgtgccacgcgaatagcaccaccggagcgc
agtttctacagcggaaacacattgtcaagtctgcttcgttccaattcgatagtgggtgta
gttcacaaatctggcgaacagcatcagggacaggaacaattatcgcgcgaaaatcgtcct
attttgcatccgccaccaacacaacaggagattgaacccacgcgcagtgtgttggaagag
ttgaaggagatttccagaaagcgcattaacaatggagaaccacacgagccgcctcacgag
ttcgccaagaaacgcatggcagaatttgtcgatccccactcgcatgtgctccaagcacca
ggactttccccgcatcagataccagccagttttaagcgtcaacgcgaacagccactgcct
ctcactgtggccgttcccctaaggcagccacataatacgccttctcctgtggcaatgcac
caccaccatttacagtccaatggagtaagtggcggcggctccatctctaaactgggcaca
cctacgcagttgtcgccagagcagcaggcagcaaagcgaagaaactgtagctacagcaat
gatattgcctcctctctgagttctagtcggcgacaatcgcacaaacgtaaattatatgat
atgcgagtaaaccagaggcagtctataacaggccacgagttatccgctcttggcgcaagc
tgcaactcctctccagaaacctcgcccagcctacaagcttcgaaaattcagcgtaaagtc
gaaatggaaagcgtatgcaaaactctaagtatgcctacgccaacaacaaccgctgtggct
gtgccggtggccagaatgcagtctgcacccaccgaaacggatgggatgcgtcacgctact
ccccccattgcccaagcgaccaagcccaaactgacactattcaatgcgcagcagaagaat
cagtcgaatcaggaacagtcatcgtcagatttaaatagccctgaggtggatgcatctgaa
tatgcgggcattcagtttgttaagcccaagcagcaaaactcaaagagcattggaatcggt
aagaatccatcaatagagcgaatgcaaaagaccaaattggccatcatgttaagtggcctg
aggggtgaaatgtatattggcgaatcggaagatgacactgatgccgcattatcaacatcg
tccaaactgatatccccaatcaagccgatcattgcggcaacaacaactataacagcgaca
acaatgacaacagctacaacaacaacagcagcaactgcgacacagactagcgagagaatt
ttgactaagccgaacgtggaatttaaattacaacctagcaacagcagcagcaacaacagc
agcagcacaatagctcaggccaattcgagctcatctggatttggtggttttagctttggt
ggtaatgctgctgctccaacaaccacgccctcattggggggctttggaaatcaacccaat
agttttctaactaactctaagcaaccagaggcacatcctgccgcctctaacactgccaca
acaactcctgcctttggcagtcaaaccaccactagctccacttcatttgccaatgcattt
aagccagcatctgaagcaaatccgaatccagcaagccaggagacaactaaggctttcagt
ttcggttcgacagcgaacaaaccagctgcggcggtggtacagcctacaacaactgccagc
acttccaatatatttggacagaatttatttggccagaagccagcggaagcagccacaact
acaactacaagcacaccctttgcatttggtggtggggctaaaccagtggcgcccactgca
gctccaactgcagcaccaacggcggcagcatccacaccgtttacattcggcggagcagcg
aaacctgcagcccctgaagcatctgcatctggatccttttcatttggcggattgaaacca
gctgcagcacccgcagctacgacaggcactgaaaaatccacaccctttgcttttggggga
gcaaagccagcggcaagcggtagtaatttgttcagctttggtggagcagcagctgccgcc
cgagcaccaaacgcaaccactttgacaggaggaggagcagcatcatcatcatcaacaacc
aatagtgccttcagtttcagtgcgaatgcagtgcaaaaacctgctgcttccgtctttggc
agtcaaaagccgtcgacgacagcaactgcaactccattttcatttggtggtgcagcagcc
gtcgagcagcaacagcagcaacaacaatcaaatcctgaagccgttgctccatctgccagt
ggcttctcttttggcgctgctatcaacaaaaccaatggcgatacaaatgctgcatcgaat
atatttggtacacaaactggtgtggtcaaacctagttttgcattcgggaacaatagcgcg
agcacaacctccaccaatgcggctcctgcacaatcctcaggttttggtggattcggtgct
gctgctgccgcaggaggagcaaccaatcaacaaagcaaaccattcagctttggaggaaac
tcatcggcttcagttgctccggctgcggctgcaattggtggaaacctttttgcaaatgct
gtggcagccgcccagtttggagctgctaacaatctgccatccactgctccaaacaatagt
gcaaccgccaagcctttcaatttcggtggtgcccaaactgctaccaacaatttgtttagc
ccatccactcagacagcagcgacagtcccgaaaccagctgcagcagcatttcaattcggc
gctccagctccagcttcgccggcaatgccaactactgcacagcagataaatgccaacaac
ctgtttgcaccaccaacagagagccgacccattagacgagccacaagacgtctgcagaag
taa

DBGET integrated database retrieval system