KEGG   Drosophila willistoni: Dwil_GK11247Help
Entry
Dwil_GK11247      CDS       T01067                                 

Definition
GK11247 gene product from transcript GK11247-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dwi  Drosophila willistoni
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dwil_GK11247
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dwil_GK11247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 690 aa AA seqDB search
MHSNLLIFIWRRKLSFLLVVSGLVLLALWSWALLIENTSTRTPQLLTTQRSDAGSYHQEV
HIIQKLIEQANRVLRADRQKDNLLELKEKKSLGNVRFLPTQQTKRAPRLPLAESLLLEQE
RLKILEQQQRQRHAGGMEELNANAGEDERMLSSAERQTQYEHELQRMGVPVVAGLGPDGP
RPPNERFIHLDLKGAPPKLSFLKQLLPILKTLGATGLLIEYEDMFPFSGALEALAARNAY
KEEELKDFLESAALHGLSVMPLVQTFGHLEYVLKLAGFEHLRELQESPQSICPSQAQGMA
LLEHMLTQVIEFHMPLSSKLTHLHLGCDEVQRLGECPACRQRMPNELFLSHVISLAHFVR
QRWPQLQVVIWDDQLRQMALSELQNSQIGSYVEPMIWVYANDIYRFIQPQLWNTYAKIFP
TAWVASSYKGAFGESLLVPPLQQHLENNLRWLAVLAKEGGRFVKGLRGLVLTGWQRYDHF
ATLCELLPVAMPSLMTSLSTVAKGYFSTNPRDNDLLRVLQCVFQPDSRRSGHPWLELHPN
AHHSQLFAVCTYPGHLIFKYAVRLYGKLQEISTYLQQTREHSAWLSDYNVRHNFSSPLRV
RDLILHTPRLIEEMRSMVGEAQQLMWEVYDEYTVSEFVEQHIYPKIEALHRQLELGEMLL
QRRTWPQRPLPLTLRLQEEMQPKPQEHQQP
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgcactcgaatctcctgatatttatttggcgacgtaaactttcctttttgctggtcgtc
tctggtctagttttgcttgctctttggtcgtgggctttattaattgagaatacaagtacc
cgtacaccgcagttgcttacgacgcaacgttccgatgctggatcctatcatcaggaggtc
cacatcatccagaaactaattgaacaggccaatcgagttcttagagcagaccgccagaag
gataatctactcgagttaaaggaaaaaaaatcattgggcaacgtgcgtttcctgcctacc
caacagacaaagcgggctcctcgattgcctttagccgagagtttattattggagcaggaa
cgcctgaaaattctcgaacagcaacagaggcaaagacacgcgggcggcatggaggaatta
aatgctaatgcaggtgaagacgagcgtatgcttagctcagcggaaaggcaaactcaatat
gaacacgaactgcaacgtatgggtgtccctgtggtggctggactagggccagatggtcca
cgaccaccgaatgaacgtttcatacatttggacttgaaaggcgctccacccaaattgagt
ttcctaaagcaactgttgcccattctaaaaactttaggggccactggattgctgatagag
tacgaggacatgtttccctttagtggagcattagaagccttggcggctcgcaatgcctac
aaggaggaggaactaaaggacttcctggaaagtgctgctctgcatgggctcagtgtgatg
cctctggtgcagacctttggtcatttggaatatgtcctgaaattggccggcttcgagcat
ttacgtgagcttcaggaaagtccccaatcgatttgtccaagtcaggcccagggaatggct
ctgctggagcatatgttgacccaagtgattgagttccacatgccgctatccagtaagctg
acacatcttcatcttgggtgcgatgaggtgcaacgcttgggcgagtgtcctgcctgtcgt
cagcggatgcccaacgagttgttcctgtcgcatgtaataagtttggcccactttgtgcgt
caacgatggccccagctgcaggtggttatttgggacgatcaattgcggcaaatggcattg
agtgaattgcaaaactcacaaattggcagctatgtggaaccgatgatatgggtttatgcc
aacgatatatatcgtttcatacagccacaactgtggaatacttatgccaagatcttccca
acggcctgggtggcctcctcatataagggagccttcggagagagtcttctagttccgcca
ttgcagcagcatcttgagaataatctccgctggttggctgttttggccaaagaaggcgga
cgttttgttaaaggactgcgtggcttggttctaacgggatggcagcggtatgatcacttt
gccacactctgtgagcttttgcccgtggcaatgccaagcctaatgacttcattatcgact
gtcgccaagggctactttagcaccaatccccgagataatgatctgttacgggtattacag
tgcgtctttcaaccagatagtcggcgttcaggtcatccatggttagaacttcatccgaat
gcccatcacagtcaattatttgccgtatgcacttatccaggacatctgatctttaaatat
gctgtacggttatatggtaagctgcaagagatttccacctatttgcaacagacgagagag
catagtgcttggctttccgattacaatgtgcggcataactttagttcgcccctcagggtt
agggatcttatcttgcacactccccgtctaattgaggagatgcgttccatggttggtgag
gctcagcagctaatgtgggaggtctatgatgagtatacggtatcagaatttgtcgaacag
catatctatcccaaaattgaagctttgcatcgtcaattggagctgggggaaatgcttcta
cagcggcggacatggccacagaggccacttccactgacattaaggttgcaagaggaaatg
cagccaaaaccacaagagcatcagcagccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system