KEGG   Drosophila willistoni: Dwil_GK11289Help
Entry
Dwil_GK11289      CDS       T01067                                 

Definition
GK11289 gene product from transcript GK11289-RA
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dwi  Drosophila willistoni
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:dwi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dwi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dwi00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MTGIISMLTRRLQIVGIKAARSQELKRGIRQYSRLSVLSAAKKQHLLRQDVTLAQHQAPR
VLGWKSFHTTTSMWSEQTIKVPPFADSIAEGDIKFTCKEGDSFAADEAVMEIETDKTTVP
VPAPFAGTVTAILVKDGDTVKPGQELFKMKPGAAPAKAAAPAPAAAKPEPAAAKPAAAAA
PAAAAPAKAAPPPPPPAAAARPPPPPPAAAPRAAAPPPVAAVKPSVAQVKLPPADGSRQI
LGTRSEQRVKMNRMRQKIAARLKDAQNTCAMLTTFNEIDMSYAMDFRKQNLEAFTKKYGI
KLGFMSIFSKASAYALQDQPVVNAVIDGQDIVYRDYVDISVAVATPRGLVVPVIRNVESM
NYADIEIALAGLADKAKRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHG
IFERPIAVKGEVKIRPMMYVALTYDHRIIDGREAVLFLRKVKAAVENPAIIVAGL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatttccatgctaaccagacgactgcaaatcgttggaataaaagccgcg
cgtagtcaagagctgaaacgcggtattcgtcagtattcccgactatctgtcttatcagca
gccaagaagcagcatctgttgcgtcaagatgttacacttgcccagcatcaagcgcccaga
gttctcggctggaagagctttcacaccactacgagtatgtggtcggagcaaacgataaag
gtgcctccattcgccgactccattgctgagggtgatattaagttcacttgcaaagaaggg
gattcatttgcggctgatgaggcagtcatggaaatcgaaactgacaagacaacggtgcca
gttccagccccatttgccggcacagtcactgctattctcgttaaggatggcgacacagtt
aaacctggtcaggaactttttaaaatgaaacctggcgccgcaccagctaaggctgccgct
cctgctccagctgctgctaaaccagaaccagcagctgccaagcccgcagctgccgctgca
ccagctgccgctgccccagctaaggcagcacccccaccgccgccaccagcagcagctgcc
cgcccaccaccacctccaccggcagcggcacctcgggctgccgctcccccaccagttgcg
gctgttaaacccagtgtggcccaagttaaactgccgccagctgacggttcgcgccaaatt
ctgggcacacgctccgaacaacgtgttaagatgaatcgcatgcgtcaaaagattgctgcc
cgcttgaaggatgctcaaaatacgtgtgctatgctcaccaccttcaatgagattgacatg
agctatgccatggatttccgtaagcagaaccttgaagcttttactaagaaatacggtatc
aaactcggcttcatgtccattttctcgaaggccagtgcctatgctctgcaagatcagcct
gttgtcaatgctgttatcgatggccaggatattgtgtaccgcgactatgtggacatctca
gtggctgtggctacacctcgaggtctggttgtacccgttattcgtaatgtcgagagcatg
aactatgcagacatcgagattgccttggctggtctggccgataaggctaaacgtgatgcc
attaccgtcgaggatatggatggcggcactttcaccatcagcaacggaggagttttcggt
tcattaatgggcacgcccattattaatccaccacaaagtgctatccttggtatgcacgga
atatttgagcgtcccattgctgtaaagggagaagtcaaaatccgccccatgatgtatgtg
gcgttgacttacgatcatcgaatcattgatggtcgtgaggctgttctcttcctgcgcaag
gtgaaggccgctgttgagaatcccgcaatcattgttgccggcttgtag

DBGET integrated database retrieval system