KEGG   Drosophila willistoni: Dwil_GK11474Help
Entry
Dwil_GK11474      CDS       T01067                                 

Definition
GK11474 gene product from transcript GK11474-RA
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 438 aa AA seqDB search
MGANVSQLEREIGTDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNAGPVNSNNNGNNGHGKSGAGGGASGGTSGVHLPGSKSNSSHSNSTTNST
NSNSNSNSNSTTTNGNSSNSTGSLNGTTSVLDGSGILTATTTPVLPTTNGANSEPTWVHE
IFQGILTSETRCLNCETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCD
NCCSYQEAQKRMRVKKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAV
NPDRLYDLTAVVIHCGSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDI
HKSSETGYILFYQSRDCA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaacgtctcgcagctggagcgcgagatcgggacggatctctttccgcccaat
gagcactactttgggctggtcaactttgggaatacctgctatagcaattcggtgctgcag
gccctctacttttgcaagccctttcgcgaaaaggtcctcgagtacaaggccaagaataag
cggcccaaggagacgttactctcatgtctggccgatctcttctatagcattgcaacgcaa
aagaaaaaggtcggttccatagcacccaagaagttcataacacgtctgcgcaaggagaag
gaggaatttgataattatatgcaacaagatgctcacgagtttcttaattttctaattaac
catatcaacgagatcattctggccgaacgcaatgcaggacccgtgaattctaataacaat
ggcaacaatggccatggcaaatctggagcaggaggaggagcatctggtggcacttcagga
gttcatttgcctggcagtaaatccaattcatctcattccaattcgacaaccaattcaaca
aactccaattcgaattccaactccaattcaaccactaccaatggcaatagcagcaactcc
acgggttccttaaacgggacgaccagtgtgcttgatggcagcggcattctaacggccaca
accacgcccgttcttccaacgaccaatggggccaattcggagcccacctgggtgcatgag
atcttccaggggatactaacatcggagacgcgttgccttaactgtgagaccgtcagtagc
aaggatgagaactttttcgatcttcaggtggatgtcgatcagaacacttcgataactcat
tgtctgcgctgcttcagcaacacggagactctttgctcggacaacaagttcaagtgcgac
aattgctgcagctatcaagaggcccagaagcgtatgcgtgttaagaaattgcccatgata
ttggctttgcatttgaagcgtttcaagtatatggagcaatttaatcgccacatcaaggtc
tcacatagagttgtctttccgcttgagttgcggctattcaatacatcggatgatgctgtc
aatccggatagactatacgatctaaccgccgtggtcatccactgtggctctggaccgaat
cgtggccattatattagcattgtcaagagccacggcctgtggttgctgttcgacgatgat
atggtcgataaaattgaagcctctaccattgaggacttctatggcctcacctcggacata
cacaagtcctcggaaacgggttatatattgttctatcagtcgcgggattgcgcctag

DBGET integrated database retrieval system