KEGG   Drosophila willistoni: Dwil_GK11483Help
Entry
Dwil_GK11483      CDS       T01067                                 

Definition
GK11483 gene product from transcript GK11483-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK11483
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK11483
Transcription machinery [BR:dwi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dwil_GK11483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 718 aa AA seqDB search
MYIDVDVCGWRVCPLAKRTKTKENSVDSTTSIVSSGSSTTSSSSSSSSSGGGGGGGGRGG
SSSSNNNKRSNAGAGVGRGTAENETLPSAAGRCACSTTAAATTATAAAAATATAANNETE
TETVTRICGWGDVGGGGGGGSSSSGGNSNDQIQQELTKGQLNATHLSACLRTVQKLAIEL
DNGNDDDVEVAAVMSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNKDAREKKSIHCNCF
ECGNYGIQLYACLHCIYFGCRGAHITSHLRAKKHNIALELSHGTLYCYGCRDFIYDSRSR
EYAVINRKLEAKDLQKSLGWQPWVPSAKETNLLLANTRRRLVRPNQTIGLRGLLNLGATC
FMNCIVQALVHTPLLSDYFMSDRHDCGSKSTHKCLVCEVSRLFQEFYSGSRSPLSLHRLL
HLIWNHAKHLAGYEQQDAHEFFIATLDVLHRHCVKAKSEHESKSNSSSSSGGGSGGGGSG
GGGSGGGSGGGSGSSGSGSNNNSSNSSSSSHCYGQCNCIIDQIFTGMLQSDVVCQACNGV
STTFDPFWDISLDLGETTSHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSYQESTK
QFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKNNSYGDFRFSLYA
VVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVLEYE
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgtacatagatgtagatgtgtgcggatggcgcgtgtgtccgttagcaaaacgaacgaaa
acaaaagagaatagtgttgatagtacaacaagcattgttagcagtggcagtagtaccact
agcagtagcagcagcagtagtagcagcggcggcggcggcggtggaggaggcagaggcggt
agcagcagcagcaacaacaacaaacgatcaaacgccggggcgggggtgggccggggaacg
gccgaaaacgaaacactaccatcagctgccggccggtgtgcttgttctacaactgccgct
gctactactgctactgctgccgctgctgcgactgcgactgcagctaacaacgaaaccgaa
accgaaactgttactagaatttgcgggtggggcgacgttggtggtggtggtggtggaggc
agcagcagcagcggcggcaacagcaacgaccaaatccagcaggagctaacaaagggccaa
ctgaatgcgacgcatttgtctgcctgtttgcgcaccgtgcaaaagcttgcgattgaactt
gacaacggcaacgacgacgacgtcgaggtcgctgccgtcatgtcagaaactggctgccgg
cattatcagagctacgtgaaggagcatagttatgacacatttcgggtcatcgatgcgtat
ttcgctgcctgcgtgaacaaagatgcgcgtgagaagaagtccatacactgcaattgcttc
gagtgtggcaactatggcattcagctttatgcctgcctgcattgcatctacttcggttgt
cgcggtgcacacattaccagccatttgcgtgccaaaaagcataatatagctttggagttg
tcgcatggcaccctgtattgttatggctgtcgagacttcatttacgattcaaggagccgc
gaatatgcagtaattaatcgtaaattggaggcaaaagacttacaaaagagtctgggctgg
cagccctgggtaccttcagccaaggagacgaatctattactcgccaacacgcgcagacga
ttggtacgaccgaatcaaacaatcggattgagaggtcttttgaatttgggtgccacttgt
ttcatgaattgcattgtacaggctctggtgcatactccgctactcagtgattatttcatg
tcagatcgtcatgactgcggcagcaagtccacgcacaaatgtttagtctgtgaagtgtcg
cgtctttttcaggagttttattccggatcacgttcaccgttgtcgctgcatcgtttattg
catttaatttggaatcatgccaagcatctggccggctatgagcaacaagatgcacacgag
ttctttattgccaccttggatgtattgcataggcattgcgtgaaagccaaatcggagcat
gagagcaaaagtaatagttcaagttcctcgggtggcggcagcggcggtggcggcagtggt
ggcggtggcagcggcggtggtagtggcggcggcagcggcagcagtggaagtggcagcaat
aacaattcaagcaactcatcctcatcatcgcattgttatggtcaatgcaattgcattatc
gatcagatatttacgggtatgctgcagagtgatgttgtttgtcaggcttgcaatggcgtt
tcaaccacatttgatcccttctgggatatctcattggatctcggcgagaccacatcgcat
ggtggtgttacgccaaagaccctaattgattgccttgaacgttacacgcgagccgaacat
ttgggttcggcggctaaaatcaaatgttccacatgtaaatcgtatcaggaatcaacgaaa
caatttagcctgcgtaccctgcccagcgttgtgtcatttcatttgaagcgtttcgaacat
tcggcgctgattgatcggaaaatttcctcatttatacaatttccggtggaattcgatatg
acgccgttcatgtcggaaaaaaataattcctatggtgattttcgtttctcgctctatgcg
gtggtcaatcatgtcggtaccatcgataccggacactacacggcctatgtgaggcatcag
aaggatacgtgggttaaatgcgatgatcatgtgataacgatggcatcgcttaaacaggtg
cttgatagcgagggttatttattgttctatcataaaaatgtgctggagtacgagtga

DBGET integrated database retrieval system