KEGG   Drosophila willistoni: Dwil_GK11634Help
Entry
Dwil_GK11634      CDS       T01067                                 

Definition
GK11634 gene product from transcript GK11634-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dwi  Drosophila willistoni
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dwil_GK11634
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dwil_GK11634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 285 aa AA seqDB search
MLKRKLQQQEAAASKVVPILQEPKAYEGLTTSALFAKPLWQRFYEIEEGLNSELQQLDIP
SNIAVVYNPVEYAASMHCDYLRRFLSGPSKRVMFIGMNPGPNGMGQTGIPFGNVRTVRDL
MHISGNVEQPPVVHPKRRVTGLDCSIEEPSGVRLWELFQTLAGGNLETFSQLCFVHNFCP
LAFFDAAGKNITPSELKGDYKKQIGTCCLRALEKQLLLVKPDYVVAVGNYVYTLLKRSTY
CQSAQLVVCLPHPSPRSVNNTNWPEKAKDFLETHNLIRFMRNETA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaacggaaattgcaacagcaagaggctgcggcatccaaagtcgtcccaatcctg
caggagcccaaggcttatgagggactgactacctcagcactgtttgcaaagcctctttgg
caaagattctatgaaattgaggaaggattaaattctgaactgcagcaactggacatacct
tcaaacatagccgttgtttataatccagttgagtatgccgcatccatgcattgtgactac
ttgcgtcgctttttgagtggacccagtaaaagggtgatgttcatagggatgaaccctggg
cccaatggaatgggtcaaaccggtataccctttggtaatgtacggacagttcgtgacttg
atgcacatatccggaaacgtcgagcagccgcctgtggttcatccaaaacgacgcgtcacc
ggactagattgctctattgaagaaccaagtggtgtacgtctttgggaactattccaaaca
ttggctggcggcaatctagagaccttctcacagctatgtttcgttcacaacttttgtccc
ctggctttcttcgacgcggcgggtaaaaatataactcccagcgagctaaaaggggattat
aagaaacaaatcgggacatgctgcctgcgtgcgctagagaagcagttgctcctggtgaaa
ccagactatgtggtggccgtgggaaattatgtgtacactctgctgaagcgttctacatat
tgccaatcagctcagctggtcgtgtgtcttccccatcccagtcctcggtctgtgaataac
accaattggcccgagaaggcaaaagatttcttggagacgcacaatttaatacgattcatg
cgcaacgaaaccgcataa

DBGET integrated database retrieval system