KEGG   Drosophila willistoni: Dwil_GK11777Help
Entry
Dwil_GK11777      CDS       T01067                                 

Definition
(RefSeq) GK11777 gene product from transcript GK11777-RA
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dwi  Drosophila willistoni
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK11777
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dwil_GK11777
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dwil_GK11777
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dwil_GK11777
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Dwil_GK11777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 395 aa AA seqDB search
MQNPIQRLVCTFGQRSYGQLPLFGVVATTTTTSRRSTKSVQPTIMANSIRQSSSSVLATE
SSNKGMIIINRPKALNAINLEMVRKIYKHLKKCEKSKSLLIIKGTGEKAFCAGGDVRALV
EAGPTDESKSFFREEYTTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVATDRTLFA
MPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADAFHAGIATHYCDVNQIPELE
TALLNCPDADDVPDLLKKFHSTPEKAFTLEPVLEKINKNFAADSVEGILENLQADGSDWA
KKTLETLCKMSPTSMKVTYRQLELGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRALLID
KDQQPKWQPSTLADVSEEHVQWFFRKLPDTEELKL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccaattcaaaggttggtctgcacattcggtcaacgatcctacggccaattg
ccgctttttggagtagttgcgacaacaacaacaacatcgagaagaagcacaaaatcagtc
caacccaccattatggccaattccatacgtcaatcttcctcctccgtgctggccacggag
tcctccaacaagggaatgattatcataaaccgtccgaaagcattgaatgccatcaatttg
gaaatggtgcgaaagatctataagcatttaaagaaatgtgaaaagtcgaaatctctgctg
attatcaaaggtacaggagagaaggcattctgtgccggcggcgatgttcgtgctctagtt
gaagccggacccacagacgagtcgaagagcttctttcgtgaggaatatacaacgaacgct
ctaatcggcaactacaagattccctacatagccattatcgatggcatcacaatgggcggt
ggagtgggtcttagtgtgcatgggaaatatcgcgtggccactgatcgcacactctttgcc
atgcccgaaacggcaataggacttttccccgatgtgggtggctcctactttctgccccga
ctgcagggaaaactgggtctatatctgggattaactggctaccgtctgcgtggtgctgat
gcctttcatgccggaattgccacccactattgcgatgttaatcaaatacccgaactggag
acggcactcctcaactgtcccgatgctgatgatgtgcccgacctattgaagaaattccat
tcgacccctgaaaaggcatttacactggaaccagtgctggagaagatcaacaagaacttt
gccgcagattcggttgagggcattcttgagaatctgcaagcagatggcagcgattgggct
aagaagacgctagagacgctgtgcaagatgtcgcccacttccatgaaggtcacatacagg
cagctggagttgggttctcagctgtctctggcccagtgcctgattatggaataccgactg
gccgtgcgccacttggaacgcagtgacttcaaagagggcgtccgcgctctgctcattgat
aaggatcagcagcccaagtggcagccatccacattggccgatgtcagtgaggagcatgtg
cagtggttcttccgcaaattgccagataccgaggagctcaagctgtaa

DBGET integrated database retrieval system