KEGG   Drosophila willistoni: Dwil_GK11777Help
Entry
Dwil_GK11777      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dwi  Drosophila willistoni
Pathway
dwi00280  Valine, leucine and isoleucine degradation
dwi00410  beta-Alanine metabolism
dwi00640  Propanoate metabolism
dwi01100  Metabolic pathways
dwi01200  Carbon metabolism
Module
dwi_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dwil_GK11777
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dwil_GK11777
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dwil_GK11777
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Dwil_GK11777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 CHIPS
Motif
Other DBs
NCBI-GeneID: 6647699
NCBI-ProteinID: XP_002069919
FlyBase: FBgn0213788
UniProt: B4NAU1
Position
Unknown
AA seq 395 aa AA seqDB search
MQNPIQRLVCTFGQRSYGQLPLFGVVATTTTTSRRSTKSVQPTIMANSIRQSSSSVLATE
SSNKGMIIINRPKALNAINLEMVRKIYKHLKKCEKSKSLLIIKGTGEKAFCAGGDVRALV
EAGPTDESKSFFREEYTTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVATDRTLFA
MPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADAFHAGIATHYCDVNQIPELE
TALLNCPDADDVPDLLKKFHSTPEKAFTLEPVLEKINKNFAADSVEGILENLQADGSDWA
KKTLETLCKMSPTSMKVTYRQLELGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRALLID
KDQQPKWQPSTLADVSEEHVQWFFRKLPDTEELKL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccaattcaaaggttggtctgcacattcggtcaacgatcctacggccaattg
ccgctttttggagtagttgcgacaacaacaacaacatcgagaagaagcacaaaatcagtc
caacccaccattatggccaattccatacgtcaatcttcctcctccgtgctggccacggag
tcctccaacaagggaatgattatcataaaccgtccgaaagcattgaatgccatcaatttg
gaaatggtgcgaaagatctataagcatttaaagaaatgtgaaaagtcgaaatctctgctg
attatcaaaggtacaggagagaaggcattctgtgccggcggcgatgttcgtgctctagtt
gaagccggacccacagacgagtcgaagagcttctttcgtgaggaatatacaacgaacgct
ctaatcggcaactacaagattccctacatagccattatcgatggcatcacaatgggcggt
ggagtgggtcttagtgtgcatgggaaatatcgcgtggccactgatcgcacactctttgcc
atgcccgaaacggcaataggacttttccccgatgtgggtggctcctactttctgccccga
ctgcagggaaaactgggtctatatctgggattaactggctaccgtctgcgtggtgctgat
gcctttcatgccggaattgccacccactattgcgatgttaatcaaatacccgaactggag
acggcactcctcaactgtcccgatgctgatgatgtgcccgacctattgaagaaattccat
tcgacccctgaaaaggcatttacactggaaccagtgctggagaagatcaacaagaacttt
gccgcagattcggttgagggcattcttgagaatctgcaagcagatggcagcgattgggct
aagaagacgctagagacgctgtgcaagatgtcgcccacttccatgaaggtcacatacagg
cagctggagttgggttctcagctgtctctggcccagtgcctgattatggaataccgactg
gccgtgcgccacttggaacgcagtgacttcaaagagggcgtccgcgctctgctcattgat
aaggatcagcagcccaagtggcagccatccacattggccgatgtcagtgaggagcatgtg
cagtggttcttccgcaaattgccagataccgaggagctcaagctgtaa

DBGET integrated database retrieval system