KEGG   Drosophila willistoni: Dwil_GK11777Help
Entry
Dwil_GK11777      CDS       T01067                                 

Definition
GK11777 gene product from transcript GK11777-RA
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dwi  Drosophila willistoni
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:dwi01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dwi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:dwi00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dwi00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 351 aa AA seqDB search
MANSIRQSSSSVLATESSNKGMIIINRPKALNAINLEMVRKIYKHLKKCEKSKSLLIIKG
TGEKAFCAGGDVRALVEAGPTDESKSFFREEYTTNALIGNYKIPYIAIIDGITMGGGVGL
SVHGKYRVATDRTLFAMPETAIGLFPDVGGSYFLPRLQGKLGLYLGLTGYRLRGADAFHA
GIATHYCDVNQIPELETALLNCPDADDVPDLLKKFHSTPEKAFTLEPVLEKINKNFAADS
VEGILENLQADGSDWAKKTLETLCKMSPTSMKVTYRQLELGSQLSLAQCLIMEYRLAVRH
LERSDFKEGVRALLIDKDQQPKWQPSTLADVSEEHVQWFFRKLPDTEELKL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccaattccatacgtcaatcttcctcctccgtgctggccacggagtcctccaacaag
ggaatgattatcataaaccgtccgaaagcattgaatgccatcaatttggaaatggtgcga
aagatctataagcatttaaagaaatgtgaaaagtcgaaatctctgctgattatcaaaggt
acaggagagaaggcattctgtgccggcggcgatgttcgtgctctagttgaagccggaccc
acagacgagtcgaagagcttctttcgtgaggaatatacaacgaacgctctaatcggcaac
tacaagattccctacatagccattatcgatggcatcacaatgggcggtggagtgggtctt
agtgtgcatgggaaatatcgcgtggccactgatcgcacactctttgccatgcccgaaacg
gcaataggacttttccccgatgtgggtggctcctactttctgccccgactgcagggaaaa
ctgggtctatatctgggattaactggctaccgtctgcgtggtgctgatgcctttcatgcc
ggaattgccacccactattgcgatgttaatcaaatacccgaactggagacggcactcctc
aactgtcccgatgctgatgatgtgcccgacctattgaagaaattccattcgacccctgaa
aaggcatttacactggaaccagtgctggagaagatcaacaagaactttgccgcagattcg
gttgagggcattcttgagaatctgcaagcagatggcagcgattgggctaagaagacgcta
gagacgctgtgcaagatgtcgcccacttccatgaaggtcacatacaggcagctggagttg
ggttctcagctgtctctggcccagtgcctgattatggaataccgactggccgtgcgccac
ttggaacgcagtgacttcaaagagggcgtccgcgctctgctcattgataaggatcagcag
cccaagtggcagccatccacattggccgatgtcagtgaggagcatgtgcagtggttcttc
cgcaaattgccagataccgaggagctcaagctgtaa

DBGET integrated database retrieval system