KEGG   Drosophila willistoni: Dwil_GK11850Help
Entry
Dwil_GK11850      CDS       T01067                                 

Definition
GK11850 gene product from transcript GK11850-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dwil_GK11850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 442 aa AA seqDB search
MTIDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLDKKMKIYRPYKASAQDM
LRFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEG
AQKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHG
DGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYELGAESGRYYSVNVPLKEGIDDQSYFQ
VFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTRGHGECVKFVKELNVPTLVVG
GGGYTLRNVARCWTHETSLLVDQDIANDLPPTEYYDFFAPDFTLHPEINSRQDNANSKQY
LELIVKHVFENLKMCQHSPSVQMVHTPPDVDMEEIRQVQKEENSDPDVRMSQADDDKLVE
SKNEFYDGDQDQDKADVGTPET
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgaccggcgagtttcatatttctacaatgccgatgttggaaattttcattat
ggagctgggcatccgatgaagccgcagcgtttggctgtaacccacagtttagttatgaac
tacggcttggacaagaaaatgaagatatatcggccatacaaagctagtgcccaggacatg
ctgcgctttcacagcgatgagtacatagcatatttgcagcaggttacgccccaaaatatc
caatgcaattctgtggcctacaccaaatatttggcccatttcagtgtgggcgaggattgc
ccagtgtttgatggcctttttgatttttgtgctatgtataccggagcgtcactggaggga
gcccaaaaattaaatcataatcacagtgatatatgcatcaattggtctggtggtcttcat
catgccaagaaattcgaagcttctggcttttgctatgtcaacgatatcgttattggcatt
ctggagctgttaaaataccatccgcgggtcctatacattgacattgacgtgcatcatggt
gatggagtgcaggaggccttttatttaacggatcgtgttatgacggcatcgtttcataag
tatgggaattatttctttcccggcaccggggatatgtacgaacttggtgccgaatccggt
cgctattatagtgtgaatgttccgcttaaagagggaatcgatgatcagagctactttcag
gtttttaagcccatcatttcggccataatggatttctatcgaccaacagccattgtgttg
caatgtggagcggattctttagcgggcgatcgcctaggctgcttctcgctaagtactcga
ggtcatggcgaatgtgttaaattcgtaaaggaactcaatgttcccactctagtagtcggt
ggtggcggctacacattgcggaatgtggcccgctgttggacacatgaaacctcactgttg
gttgatcaagatattgccaatgatttgccacccacagaatattatgacttctttgctccc
gactttactttgcatccagagataaattcccggcaggataatgccaattcaaagcaatac
cttgaactaattgtcaagcatgtgtttgagaatctgaaaatgtgtcaacactcacccagt
gtacaaatggtacatacaccacccgatgtcgacatggaagagatcaggcaagtgcagaaa
gaggagaattcggatccagatgtgcgcatgtcccaggcagatgatgataaattggtggaa
agcaaaaatgaattctatgatggggatcaggatcaggataaagccgatgtgggaacacca
gaaacttag

DBGET integrated database retrieval system