KEGG   Drosophila willistoni: Dwil_GK11864Help
Entry
Dwil_GK11864      CDS       T01067                                 

Definition
GK11864 gene product from transcript GK11864-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dwi  Drosophila willistoni
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dwi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dwi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 183 aa AA seqDB search
MLRFNLIVAVCENSGIGLKGDLPWRIRSELKYFSNTTKRRLDSSKRNVVIMGRKTYFGVP
PSKRPLPDRVNVILSSTLKSNELPNEVLIYSSLEGAMQELEKQKDQIENVWIVGGSSVYA
ESMASPRCHRLYLTKIYAEFECDTFFPKIPESFREVSPDKDTPPGIQEENGLKYEYKVFE
KQE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgttttaacctaattgtggccgtttgcgagaattcaggaatcggtctcaaagga
gatttgccttggcgaattaggtcagagttaaagtattttagcaacaccacgaaacgccgc
cttgattccagcaaacgaaatgttgttattatgggcagaaaaacctactttggagttccc
ccaagcaaacgccccttgcccgatcgtgtgaatgtcatacttagttccacactcaagtcg
aatgagctgcccaacgaagtccttatttattccagcctcgagggcgctatgcaagaactg
gaaaaacaaaaggatcaaattgaaaacgtttggattgtaggcggaagcagtgtctacgcc
gagtccatggcatcgcctcggtgtcatcgcttgtatctaacgaaaatctatgcagaattt
gaatgtgataccttctttcccaaaatacccgaaagtttccgtgaagtgtcccctgataag
gacacgccaccgggcattcaagaggagaacggccttaagtatgagtataaggtttttgaa
aagcaagaataa

DBGET integrated database retrieval system