KEGG   Drosophila willistoni: Dwil_GK11864Help
Entry
Dwil_GK11864      CDS       T01067                                 

Definition
GK11864 gene product from transcript GK11864-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dwi  Drosophila willistoni
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dwil_GK11864
   00670 One carbon pool by folate
    Dwil_GK11864
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dwil_GK11864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 183 aa AA seqDB search
MLRFNLIVAVCENSGIGLKGDLPWRIRSELKYFSNTTKRRLDSSKRNVVIMGRKTYFGVP
PSKRPLPDRVNVILSSTLKSNELPNEVLIYSSLEGAMQELEKQKDQIENVWIVGGSSVYA
ESMASPRCHRLYLTKIYAEFECDTFFPKIPESFREVSPDKDTPPGIQEENGLKYEYKVFE
KQE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgttttaacctaattgtggccgtttgcgagaattcaggaatcggtctcaaagga
gatttgccttggcgaattaggtcagagttaaagtattttagcaacaccacgaaacgccgc
cttgattccagcaaacgaaatgttgttattatgggcagaaaaacctactttggagttccc
ccaagcaaacgccccttgcccgatcgtgtgaatgtcatacttagttccacactcaagtcg
aatgagctgcccaacgaagtccttatttattccagcctcgagggcgctatgcaagaactg
gaaaaacaaaaggatcaaattgaaaacgtttggattgtaggcggaagcagtgtctacgcc
gagtccatggcatcgcctcggtgtcatcgcttgtatctaacgaaaatctatgcagaattt
gaatgtgataccttctttcccaaaatacccgaaagtttccgtgaagtgtcccctgataag
gacacgccaccgggcattcaagaggagaacggccttaagtatgagtataaggtttttgaa
aagcaagaataa

DBGET integrated database retrieval system