KEGG   Drosophila willistoni: Dwil_GK11893Help
Entry
Dwil_GK11893      CDS       T01067                                 

Definition
GK11893 gene product from transcript GK11893-RA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK11893
   01230 Biosynthesis of amino acids
    Dwil_GK11893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK11893
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dwil_GK11893
Enzymes [BR:dwi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dwil_GK11893
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dwil_GK11893
  Exosomal proteins of melanoma cells
   Dwil_GK11893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWFDANLSDKGKEEALAAGKAVKDAGLEFDVAHTSV
LTRAQVTLASILQASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHAYYDTIVKDPRYADGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcaagtacaagattgtgatggtccgtcatggcgaatctgagtggaatcagaag
aatcaattctgcggctggttcgatgccaatctcagtgacaagggcaaggaggaggcccta
gccgctggtaaggctgttaaggatgcaggcctcgaattcgatgtggcccacacttcggtt
ttgacccgtgcccaagtgactctagccagcatattgcaagccagtggccacaaggaaatt
cccatccaaaagacttggcgtctcaatgaacgtcactatggtggtctaaccggtctgaac
aaggccgagacggctgccaaatacggtgaggcccaggtgcaaatctggcgtcgcagcttc
gacacaccaccacctccaatggaaccaggccatgcgtactacgataccattgtgaaggat
cctcgttatgctgatggacccaagcccgaagagttccctcaattcgagtccctcaaattg
accatcgaacgtacactgccatactggaacgatgtgatcattccacagatgaaggagggc
aagcgtatcctgattgctgcccatggcaacagtctgcgaggcattgtcaagcatttagat
aatctctctgaggatgctattatggctctgaatctgcccactggtatcccattcgtttat
gagttggatgaaaacttcaagcctgtggtgtccatgcagtttttgggtgatgaggagaca
gtcaagaaggccattgaagccgtggctgctcagggcaaagccaagtaa

DBGET integrated database retrieval system