KEGG   Drosophila willistoni: Dwil_GK11929Help
Entry
Dwil_GK11929      CDS       T01067                                 

Definition
GK11929 gene product from transcript GK11929-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dwi  Drosophila willistoni
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dwil_GK11929
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dwil_GK11929
Transfer RNA biogenesis [BR:dwi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dwil_GK11929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 313 aa AA seqDB search
MATSTVSPIIMRIMAASIKTSVKAASIIRDVLKTGDLGIVDKSNKNDTQIDPQTLADRSA
QRCIIASLTKKFPSVKIIGEEGDSDLNVPSDWLVEDLDEAFLEQSCPSEWKDVKPEDFVI
WVDPLDGTAEYTQGFVEHVTVLIGIAVKDAAVGGVIHQPFYKHPSGELGRTIWGLKGLGT
GGFVPILPPTGQFIITTTRSHSNALHQQALNSFNATQTIKVGGAGFKVLQLLEGKAHAYV
FATPGCKKWDTCAPEAVLEAQGGTLTDIDGNHYAYNASVEHINRKGVLATVGQDHAELVS
KIPLEVRQAVGNK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagcactgtgtctccaattataatgcgaattatggccgcttcaatcaagact
tcggtgaaagcggcttccattattcgtgatgtcctcaaaacgggcgacttaggaatcgtc
gataaaagtaataagaacgatacacaaattgatccacaaacattggcagatcgatctgcc
caaaggtgtataattgcctcgttaaccaaaaagttccccagcgtaaaaataattggcgag
gagggcgactctgatttgaatgtgccttcggattggctggtggaagacttggatgaagca
ttccttgagcagtcttgtcctagcgaatggaaagatgttaaaccagaggattttgtcatt
tgggtggatccgctggacggtaccgcagagtacacacagggctttgtggagcatgtgact
gttcttattggcatagctgttaaagatgcggcagtgggtggcgttattcatcagcccttc
tataaacatccaagcggtgagcttggacgcaccatttggggcctaaaaggcttgggtaca
ggtggattcgttccgattttaccacctaccggtcagttcataattactaccactcgatcg
cattccaatgctttgcatcagcaggcactgaactcgtttaacgctacccagaccataaaa
gtgggcggcgctggttttaaagtccttcaattgctcgagggaaaggcacatgcttatgtt
tttgccacgccgggatgcaaaaaatgggacacttgtgccccagaagctgtactggaagcc
caaggtggcacactgaccgatatcgatggtaaccactatgcctacaatgcaagtgtggag
cacatcaatcgtaagggagtgttggccactgtgggtcaggatcatgcggagctagtgtcc
aaaataccgcttgaagtgaggcaggcagtaggcaataaataa

DBGET integrated database retrieval system