KEGG   Drosophila willistoni: Dwil_GK12118Help
Entry
Dwil_GK12118      CDS       T01067                                 

Definition
GK12118 gene product from transcript GK12118-RA
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
dwi  Drosophila willistoni
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK12118
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Dwil_GK12118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 479 aa AA seqDB search
MTTAVLGGGISGLSAGYYLLRRFGKPLTIYEASPRVGGWIRSETHKDRGFLFESGPRTIR
PVGLPGANTMEIVEQLNLPVRAIPRSHVAAKNRMLYAKGQVCMLPNSPMGLFGTKPPFSQ
PLYKAFIHDLLAKSTLAKHGDESIYSFAERRFGKEIADYAISPMICGICAGDAREISVRF
LMDGLFEKEQKYGGVLKGLFYARYKEKNSTKPGIFAQEQTKMYLQSKQEKWAMYGMDGGL
EQLPRALRKYLGENDVNVQLSNPCRNLTFSDNGVRLSLRDADLPVDHVISSLPAYRLAAL
VKQQHPSLSAQLLDIPYVDVVVVNIQFEGNNLLKQNGFGLLVPPCEQLPVLGVIFDSCCF
DMDGNTILTVMMGGRWFDQWFSDQPSPKKLLDTALRYVRQILEIKEDPKFCRVHTHHKCI
PQYTVGHKHRVANIRKYIKTYKLPLSLCGAAFDGVGINDVILSARRQVEALPQSFSHPT
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggccgttctgggcggcggcatcagcggcctctccgccggctattacctgttg
cggcgattcggaaaaccactgaccatctatgaagcctcgcctcgagtgggcggctggata
cgttccgagactcacaaggatcgaggattcttgtttgaaagcggtccaagaaccatacgt
cccgtgggactgcctggagcaaatactatggaaattgtggagcaattaaatctgccggtt
agggctataccacgatctcatgtggctgccaagaatcgaatgctatatgccaaggggcaa
gtgtgcatgttgcccaatagtcccatgggattgtttggcacaaagccgccgttcagccaa
ccactgtacaaagcctttatccatgatcttctggctaaatcaacattagccaagcatgga
gatgagtcgatctatagttttgctgaacggcgctttggtaaggagatagcagactatgcc
atcagccctatgatttgtggcatttgtgccggcgatgctcgagagataagcgttcggttc
cttatggacggcctgttcgagaaggagcagaaatacggaggcgttttaaagggtttgttc
tatgcgcgttacaaggagaaaaattcaaccaaaccaggcatattcgcccaagagcagaca
aagatgtaccttcaatcgaagcaggagaagtgggccatgtatggcatggatgggggattg
gagcaactgccacgagcattacgcaaataccttggcgaaaatgatgtcaatgtgcagtta
tccaatccgtgtcgaaatctaacgttcagtgacaatggagtgcgactcagcctgagggat
gcagatctgccggtcgatcatgtgataagttcgcttcctgcatatcgcctggcggccctg
gtgaagcagcagcatccatctctgtccgctcaactgctggatattccctatgtagatgtc
gtggtggtgaatatacagtttgaaggtaacaatctgctcaaacaaaacggttttggtctg
ctcgttccaccctgcgaacaattacccgttttgggtgtaatctttgatagctgctgtttt
gacatggacgggaatacaattcttacggtgatgatgggtggtcggtggtttgatcaatgg
ttcagtgatcagcccagtcccaagaagctgctcgacacggcattgcgttatgtacgtcaa
atactggagatcaaggaggatcccaaattctgccgagtgcatacgcatcacaaatgtatt
ccccagtatacagtgggccataagcatcgcgttgcaaacatacggaaatacattaagacc
tataagctgccattgtctctgtgtggtgctgcctttgacggtgttggaatcaacgatgtc
atcctttcggcccgccgacaagtcgaggccctaccccagtcattttcccatcccacttaa

DBGET integrated database retrieval system