KEGG   Drosophila willistoni: Dwil_GK12120Help
Entry
Dwil_GK12120      CDS       T01067                                 

Definition
GK12120 gene product from transcript GK12120-RA
Orthology
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dwil_GK12120
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK12120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 4007 aa AA seqDB search
MCEVCADFQNLLELYEVRVSSSELKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDTKNYD
RFNLVVQSLICLTVQHLKHIDHLIENYKRLTASAAQVVAQAQQQQQLQQQQQQQRESNND
ADFQTDGEINIKHKEATTKENSNHNKKTSDEADTGTGTAELDEKQGSGDGITIKRPIGPS
TPPPLTPPPQQPATSVSSSAASSSSSSSSINPSNAKPLHPMQYTEEPWILPEVEKLLVLV
SKVFLLNFPLYIAHKHGMHSRLDDLQAEEAHHLALICDLHDNDLPIYLLRNVSLFCNSGG
FNAMSICFEHPDLPVSTAHSMTATVSNVKLWLNYHCNTQLFVPLRSRILQYMCKLSDQNL
RSAATRAMADFVWSSMRDPLDVAVNFDTEGLALAFKYFTSTTLTMRLAGMAQINAHINLF
NEICTTETVNEVELFGQRIANWLTENHIVQHLFGPNLHVEIVKQAHVLLNFLAVENQISE
EDIKLIWQATQLKHCSKTIFDILPSLVKNLAPRPAMHLYSLLCRMDPKEHTEQSIYIASA
LTKLLWTRDCSRSQMNLMQDHLLGSNVTASSSDSGSIEGSNTEDDHVGADDSSIASGGGG
GDGHKSPIDGVPPCKQARHRRHICDPTTEKGKQLSAEDLAKVDIKNHRIVNIIDNTSSEE
ELQSRAALELQLHRSRKKTSNKRRRQKVANKQILLPHELVEIWDGAEDVPSSDDVDADGD
GELLADSDDCSDGAASQLPAAVLKHLHGEGPYIRAIAETNISELLSGAENDGSYSSPMSN
KSEKNLADFDDEDVSPCEEELAQLVNSHAGRVAAAAAAASGANCRDVPPAFAAAAAAMMV
AQSAMAMQKSGETNVAAAAAAVAAAAVATGTAQQSLVAMRQQANAAAAAAAAAAVVQASV
KSKSDSDVELLEATIGVSGKQQHHSPKANSSSASSSTPVQPSFKLNDVCQPGNTLLWDLL
QDDKIGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLYNVANNRSVIVSLRLLPKL
FASFQQFRPADTHSMTLWAERTHRMMPCFFNNIRHYARRHAELIVNQNGEQQHYLLHMGE
QLYSHKTQVSVRLQFLSSIFSTVGSPKTFRLTLEQLDALWEWLAHDPECADCYFSWLQAQ
AKGGDQHALGIDALQHLYLKKLPELRPEEFSMVALGLFQQLCNFARIAMAEYDKQREQIS
SSASAVGMYHLWKIALRAQSNEVSLAAIQYINMYYMGQQLRLEKEFVSQCMDNLVQAATA
LESIEDENALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGVGSHSNLKNEGAGPPL
RIVLQQAGLSEKSLLQMHACDLIADLKAEISKWWESLQTGMTAPVLGLLLSDGPLRIITQ
GQELTSDYDERTLGDAGFKDNQIVYVSLGGRGARRKESNLEHPSMLPPPPKECLPTVLLL
QPKYFEKLFCLMQTLGDMKPQTSTIHLQHHTKAQLLSRRVWDILAMLPTNPHILDAFKSL
VLEQSELDQLELSVAEEKEEQLINKRKQIKQKFNELLDPSNLQKFMYSLHIVESLALSSG
NSRRERDREREANSNGSHTSLVISEQPRSKKSSGNRRRNSNEQQQQQQHMTTTPESKRSN
ISDSSKEQHLSSSEPEGQGTSAEMDTEASSSGGDKENQPKQHSKRRKKSETVEQERDRDR
TLDCVTPPSPVTAPPPPPLTTLAHSNSNAGSPHLLADNKWSEAFIKCGGLRHLYEIFSSG
LLQRSTHPKEVALNEWRHDCLASLLRILWLLGFEELQSPDIHVLMSRPHAFMLKLMEVPS
CLRRLSSILNDEVYQHPTANSLVFPYQFHQLRTGFWGRAQLIQFTMNILVSFVHASPEAR
CLLWSQADHSSWLQKFILEDPEPSVRREICAGLYRICLGNVQSYRLLLAPLLHKLIALLP
LAEQMTSTVQHAQFLLSEEGKEPYGPACRDYFWLLARLVDTLSPEMVDEEHIDIERLCES
ISQSILTREYYELRHGFQDDGLVGLLNLMSNLIKYDTSFKYTPKALSFIEQLIGFLFDMP
SPADRQKPKCKSGTSRAAAYDLLVELCRGCATNYTYLHNRLLSQHKSGPKQPYPWDYWPR
DEGRSECGYVGLTNLGATCYMASCIQHLYMMPQARAAILRIPPAGALKHGSTLMEMQRMF
AYLLESERKAYNPRSFCRVYQMDHQPLNTGEQKDMAEFFIDLVSKLEEMTPDLKHLVKRL
FCGTLSNNVVSLDCGHVSRTAEEFYTVRCQVADMRNLQESLDEVTVKDTLEGDNMYTCSQ
CGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYVEKTLM
PQQYKEEREKRQNAEATGDENEKAEATLDADIEECYEYELVGVTVHTGTADGGHYYSFIK
ERTRSTYHPHERWFLFNDAEVKPFDPSQIAAECFGGEMTSKTYDSVTEKYLDFSFEKTNS
AYMLFYERRLPEHLQRRHSELLVTPTPSPTVEDKPDGDEATKMEVSSNESKQDELEQAEP
ANKTSDKEKEKADDPKDESTVSKGEKLEDKNEQEEQKQITANCDKSKPSNSNNTSNSSNN
SSNCNANEQPLASTSKAAHKLQLFRPFLNKELEDWIWQDNRQFLQDRNIFEHTYFNFMWQ
ICGHIPQTLNSEKDVTCMAAKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASQDACEW
FLSHMSLEPFWPVQVLIQCPNQMVRQMFQRLVIHVIQRLRASHADLYLDVETDEDDKELI
GQTSCVTRFIGSLISLLEHGARSHLRHLSEYFGLLCEFSRMGDEEAMFLLRVGILKSLVD
FYLGHKQTDSIDISSDNEDNSSDEALSVEKMRPASLDKMIALCASLVERSRGADFRLRLS
PKDFSAIAGGKGFPFLYQQIKDGINPHQTKHLIYALCRWEEHLATQIISMLFASVTKHTE
LCTPFFKLLTLLTETQGGPVGLPCFTQLILPRMWDAAEYCPQSVLDWLSLQATKNKIAHA
WILQSAEQWVEQFLLAHDNTRVRNAAACLLVALVPSQPFRANFRAHSQHKLLALNPHSYR
DINTDAQAVLHQVITLLLRLLRPARVYADIGAHGTTKLTAYFNLLSYCMVSKTEKLMIGS
FMRSLWELFHPRLSEPSVPAHHNKHALLTFWHHSLVDCPENAALVANCPEITRNIAFNYI
LADHDDAEIVTYNRSMLPAYYGLLRLCCEQSRALTRQLSQHQNLQWAFKNITPHPTQYAA
AVDELFKLMALFATRHPDASEQEKLDVTQFRRAVIMSYTSSLDARVSWSTLISALKILVD
NEDDRMLVIFNGGIEMCCEALHTLHSMHHEATACHVAGDLFDLLGEMMLLLATLRTRTDS
PAQKKQQLEQQLQLQQQQLLQKQQQTQCTQTPQTPHQKEKQLQQQMQQHLQLQQLQQMQF
QQQHFLRQQHQHSALAKALPDAIKRLATLLNTFNSPEISRMTLEVLKELVRNTSLEATSI
LAPILINCHLSVANAPNAIGPLGPYFPRRGAKHQHTPWPLGSKNSPRPPRPMVQMSIALS
ELTPLGLDVDYDAQVEAFYRPYHDFIDVMMRMCVNTGTLNDTLVKLHCLVAIESTPLHFN
YFPKFWVGIHNNALTHKYSELLVKNQLLVEYLHNVLRDERSMLKDACVREFLELYYHKVA
AQLPVARMIYTINYGMHSKDDIDELCGDLFAIRIIAQATGVPASVRKELRGSLRALQNKG
ERFRKETERDQLPNKKQKRESGREKDNEQTKGGAAAEDEKSETVAGETTSLIETAKPTDV
SMEVSSDANTDTIIKPPTPSGSEDDQMESTSSERLEKTSLPSSDDETELEDELEPTPKRN
KKSISKKTAQDRINEDREKRLTTLITMESYIQSIFTIMKREPGAAPSTSTTCKDQADEQS
LETASTSAAASAKARPKGAYTPPEPMPEEIDPKSCSMELESMFCRRTENDTSEYETTSQP
LRPSPPQSPTATVSNGSQPTESPPAVVVDMAAPVVASTSQAASPTQI
NT seq 12024 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaggtgtgcgccgatttccaaaatctcctagagttgtatgaagtgcgtgtgtct
agctcagagttgaaatttcagcttcttttaaagagcgaaatcgagacgacatttaactac
atccaatcctggccccagcgccaatgtatgtgtctctatcgggacaccaagaattatgat
cggttcaatttggttgtgcagtccctcatttgtctgactgtgcaacatctgaagcatatt
gatcatcttattgaaaattataagcggctaaccgccagtgccgctcaagtggttgctcag
gctcaacaacaacaacagctacagcagcaacaacaacaacaaagagaatccaataatgat
gcagatttccaaacggatggtgagatcaatatcaagcataaggaggctaccacaaaggag
aatagtaatcacaataaaaagacgagtgatgaagccgacaccggcactggcactgctgaa
ttagacgagaagcagggatcgggcgatggaattacaattaaaaggccaattggtcccagc
actccacctccattaactccgccacctcagcaacctgccacatcagtttcctcatcagca
gcgtcctcgtcgtcatcatcatcatcaataaatccatccaatgccaagcccctgcatccc
atgcagtatacggaggagccctggatattacctgaagtggagaaacttctagtgctcgtc
tccaaagtattcctgctcaatttcccgctctacattgcccacaagcatggtatgcactcg
cgcctcgatgacctacaggcggaggaagctcatcatttggccctcatctgtgatctgcac
gacaatgatcttccaatatacctgctacgcaatgttagcctgttctgcaactcaggaggc
tttaacgccatgtccatttgctttgagcatcccgatttgccggtgtccaccgcccattcc
atgactgccaccgtatcgaatgtaaagctctggctaaactatcactgtaacacgcagctg
tttgttccgctccgtagccgaattttgcagtatatgtgcaagttatccgatcagaatctt
cgatcggcggccaccagagcaatggcagatttcgtatggtcctccatgcgagatcccctt
gatgttgctgtcaactttgatacagagggtcttgccctggcgtttaagtacttcacatca
accacactgactatgcggctagcggggatggcccaaataaatgctcacatcaatcttttc
aatgagatttgcaccactgagactgtaaatgaagtggagttatttggacagaggatcgcc
aattggttaactgagaatcacattgtgcagcacttgtttggcccgaacctgcatgtagag
attgtcaaacaagcccacgtattgcttaattttttggctgtcgaaaatcaaatctccgag
gaggatatcaaacttatttggcaggcaacacagctgaagcattgctccaaaactattttt
gatatattgccatcgctcgtgaagaatttagctccacgtcccgccatgcatttgtattcg
ttgctttgtcgtatggaccccaaggagcacacggagcagagtatatatattgcctcggct
ctgaccaaattgttgtggacaagagattgttcgagaagtcagatgaacctgatgcaggac
catctgttgggatcgaatgtgactgcttccagttcggacagtggcagcattgagggtagc
aatacagaggatgatcatgtgggtgccgacgatagtagcatagctagcggtggaggcggt
ggtgatggtcataagagtcccattgatggcgtgcctccatgtaaacaagcaaggcatagg
cgacacatctgcgatcccacaaccgaaaagggtaaacagctaagtgctgaggatctggcc
aaagtggatataaaaaatcatcgcattgttaacatcattgacaataccagcagcgaggag
gaattgcagtcaagggctgccttagaattgcagctccatcgcagtcgaaagaagaccagt
aacaagcgacgtcgccaaaaggtggccaataagcaaatacttttgccacacgaacttgtc
gagatctgggatggcgccgaagatgtgccaagtagtgatgacgtcgatgccgatggcgat
ggcgagctgctcgcagacagcgatgattgtagcgacggcgcagctagtcagctgcctgct
gccgttctgaagcatctccatggcgaaggtccctatataagggcaattgctgagaccaac
attagcgagctactgagtggagctgaaaatgatggcagttactcttcgccaatgagcaac
aagtccgagaagaatctcgccgatttcgacgacgaagatgtctcgccctgcgaagaggaa
ctggcccagctagtcaactctcatgctggtcgagtggctgcagcagcagctgctgcttcc
ggtgccaactgtcgagacgttccaccagcatttgctgctgctgcagcagccatgatggtg
gcacaatctgccatggccatgcagaagtcaggtgaaacaaatgtggccgcagctgctgct
gcagtggctgctgccgctgtggccactggaacggcacaacaatctctggttgccatgcgg
caacaggcgaatgcagctgcagcggctgctgccgccgctgctgttgtccaggcgtccgtg
aaatcaaaatccgattctgatgtcgaattactagaagcaacgataggagtaagcggcaag
cagcaacatcattcgcccaaggcaaatagctcgtctgcatctagtagtacacctgtgcag
ccttcgtttaaactgaatgatgtttgccaacctggaaacacattgctgtgggatctgctg
caggacgataaaattggccaactgggtgaatctcttgctttggaggccgaaaaggcatta
gccacattgctctgcttcagtatggaccgtcagttgaggaccaaattcattgagggatgc
ctgtacaatgtggccaacaatcgaagcgttattgtcagtttgcggctattgccgaaacta
tttgcctcgttccaacagttccgtcccgcagacacgcactccatgactctgtgggcggag
cgaactcatcgaatgatgccctgcttcttcaataacattcgccactatgccaggaggcat
gctgaattgatagtgaaccagaatggcgagcagcaacattatttgctgcacatgggcgaa
caactttactcacataagacacaggtttcggttcggctgcagtttctctcgtcgatcttc
tccacagtcggttcgccaaagacctttcgcctcacactcgagcaattggatgcattgtgg
gagtggctggcgcatgatcccgaatgtgcggattgttatttctcctggttgcaagcacag
gccaagggtggggatcaacatgcattgggtattgatgcattgcagcatttgtatttaaag
aaattgccagaactgaggccagaggagttctccatggtggctttgggattgttccagcag
ctctgcaactttgcacgtattgccatggctgaatatgataagcaaagggaacagatctca
tccagtgccagtgctgtcggcatgtatcatctatggaagattgctttgcgagcccaaagc
aatgaagtttctctggctgccattcaatatattaatatgtactatatgggtcagcaactc
cgtctggagaaggagtttgtatcccagtgcatggataatttggtccaagcagccacggcc
ctggaaagcattgaggatgaaaatgcgttgatgcgtgtgcaacgtggactacttctgttg
aacacgcacttggacacattccggcggcgatatgctttccatctgcgtcgatgggccata
gagggcaagggtgttggttcccatagcaatcttaagaacgaaggagccggtccgcccctg
cgcattgtgctccagcaggcgggtttatctgagaaaagcctcctgcagatgcatgcctgt
gatttgatagccgatctcaaagcagagatttcaaaatggtgggaaagcctgcaaacaggc
atgacagcaccggtattgggtcttctgttaagtgatggaccactgcgcattattacacag
ggacaggaactgacttctgactacgatgagcgcactttgggggatgcgggctttaaggac
aatcaaattgtttatgtatcgcttggcggtcgtggagctcgtcgtaaggaatccaattta
gagcatccatcgatgttgccaccacctccaaaggaatgcctgccaacagtgttgttactg
caacccaaatactttgaaaagctcttctgtctgatgcaaacattgggcgacatgaaaccg
cagacatcaaccatacatctacagcatcacacaaaggctcagctgttgtcgcgtcgtgtt
tgggatatattggccatgctgccgactaatcctcatattttggatgccttcaagagtctg
gtgctcgaacagagtgagctcgatcaattggaattgtctgtcgccgaggagaaggaggaa
caactgatcaataagcgcaagcaaataaaacaaaagttcaatgaactgcttgatcccagc
aatttacaaaaatttatgtactcactgcacattgtcgagagtctggccctgagtagtggc
aatagccgccgtgagagggaccgggaacgagaggccaacagcaatggcagccatacgagt
cttgtcatcagtgaacaaccgcggtccaagaagagcagtggaaataggcgaagaaatagc
aatgaacagcagcagcaacaacagcatatgacgacgactccagagtcaaagcggagcaat
atcagtgatagtagcaaggagcaacatttaagtagctccgagcccgagggtcagggaaca
tctgcagagatggacacggaagcctccagcagtggcggtgacaaagagaatcaacccaag
caacatagtaagcggcgcaagaagagcgaaactgtggaacaagagcgtgatcgggatcgt
acgctggactgtgttactccaccatcgcctgtaactgcgccaccgccgccgccattgact
actctagcacattcgaactcaaatgccggttcaccacatcttcttgctgacaataagtgg
agtgaggcattcattaaatgcggtggtttgaggcatctctatgagatcttcagttctggc
ctactacagcgcagcacacatcccaaggaggtggcgctaaatgaatggcgacacgattgc
cttgctagtttgttgcgcattctttggctgctgggttttgaggagttgcagtctccggat
attcacgtacttatgtcacgtccacacgcctttatgctaaagttaatggaagtgccgtca
tgtttacgaagattgtccagcattctcaacgacgaggtctatcaacatcctacggcgaac
tctctagtgttcccctaccagtttcatcagctgcggaccggcttttggggaagggcccaa
ctcattcaattcacaatgaacatattggttagctttgtccatgcatcgccagaggctcgt
tgtttactctggtcacaagcagatcacagcagttggcttcaaaagttcattctagaggat
ccagagccatcggtgcggcgtgaaatctgtgcgggactctatcgcatttgtctgggcaat
gtgcagagctatcgactgcttttggctccgttgttgcacaaattgattgctttgttgccg
ctggccgagcagatgacgtcgacagttcagcacgcacaattcctgctatccgaggagggc
aaggaaccctatggtcccgcctgccgagattacttctggctcctggccagacttgtggac
accttgtcacccgaaatggtagacgaagagcacattgacattgaaagactctgcgagagt
atatcgcaaagtattcttacccgcgaatattatgaactgcgccatggtttccaggatgat
ggtttggttggtttgcttaatctcatgtcaaatctcatcaaatacgacacgagtttcaag
tatacgcccaaagcactgagctttattgagcagttgattggtttcctgttcgatatgccg
tcgcccgcggatcggcagaagcccaaatgtaagtcgggcacctcccgagccgctgcttac
gatttactggtggagttgtgccgaggatgtgccaccaattacacttatctacataatagg
ctgttgtcgcagcataaatctggacccaagcaaccatatccctgggattattggccacgg
gatgaaggaagatcagaatgcggctatgtgggactgaccaatttgggtgccacctgttat
atggcttcctgtatccagcatctgtatatgatgccacaagccagagcggcaattctgcga
attccccctgcaggtgccctcaaacatggatctacgctaatggagatgcagaggatgttt
gcctacctgttggaatcggaacgaaaggcctataatccgcgaagtttttgtcgtgtctat
cagatggatcatcaacctttaaacacgggcgagcagaaggacatggctgagttctttata
gatctggtgtcaaaattggaggagatgacgcccgatctaaaacatttggttaaacgtctt
ttctgtggcactctcagtaacaatgttgtttcgttggactgtggccatgtctcacgcact
gctgaggaattctacacggttcgttgtcaagtggcagatatgcgcaatctgcaggagtca
ctggatgaagttactgtcaaggatactctggagggtgataatatgtacacctgttcgcag
tgtggcaagaaagtgcgagccgagaaacgcgcttgcttcaaaaagttgccccaaatattg
tgcttcaatacgatgcgatataccttcaatatggtcaccatgctcaaggagaaggtcaac
acgcatttctcttttccgctgcgactcaatatgtgccactatgtggagaagacattgatg
ccgcagcagtataaggaggagcgagagaagcgacagaacgcggaggcgacaggggatgag
aacgaaaaggctgaagcaacattggatgcggatattgaagagtgctatgaatatgagctg
gttggcgtcactgtgcacactggtacggcagatggtggtcactattatagctttattaag
gagcggacgagaagtacctatcatccccatgaacggtggtttctcttcaatgatgctgag
gtcaaaccctttgatccctcacaaattgctgccgaatgttttggtggtgagatgacgagt
aaaacctatgattcggtgacggaaaagtatttggattttagtttcgagaaaaccaattcc
gcatacatgctattttatgagcgacgactgccagagcatctgcaacgacggcattccgaa
ttattggtcaccccgacgccgagtcccacagttgaagataagccagatggagatgaagca
acgaaaatggaagtaagctctaacgaaagtaaacaagatgaacttgagcaggcagagccg
gcgaataagacatcggataaagaaaaggaaaaggcggacgatcctaaggatgagtcaacc
gtatccaaaggcgagaaacttgaggataagaatgaacaggaggagcaaaagcaaataaca
gccaattgtgataaatctaagccaagcaacagcaacaacacgagtaacagtagcaacaat
agcagcaactgcaatgcaaatgaacagccattggcatccacctcaaaggctgctcataaa
ttgcagctatttcgtccatttttgaataaagagcttgaagattggatctggcaggacaat
cgacaattcctccaagatcgaaatatcttcgagcacacctatttcaacttcatgtggcaa
atctgtggacatataccgcaaacattgaactccgagaaggatgtgacttgcatggccgcc
aagctgtccgtttcattcttcatcgagacattcatacatgccaaggaaaagcccacaatg
gtgccatgggttgagctactgactaagcaatttaatgccagtcaagatgcctgcgaatgg
ttcctatcgcacatgtcactggagccgttttggccggtacaggtgcttatccaatgtccc
aatcaaatggtgcgtcaaatgtttcagcgtctggtcatccatgtcatacagagattacgt
gcctcacatgcagacctctatttggatgtggaaacagatgaggatgataaagagctaatt
ggtcagacctcttgtgtgactcgcttcattggttcactaatctcacttcttgagcatggg
gcgcgctctcatttgcgtcacctttcggagtattttggtttactatgtgaattctctcgc
atgggtgatgaagaggccatgtttttactgagagttggcatacttaaaagcctagtggac
ttctatttgggacacaaacaaacggatagcattgacatcagttcggataatgaggacaac
tcgtcggatgaggctttgtcggtggagaaaatgagaccagcctcacttgacaaaatgata
gcattgtgtgccagtctcgttgaaagatcgcgcggtgctgactttcgtttgcgcctctca
cccaaagatttcagtgccatcgccggtggcaagggattcccatttttgtatcaacaaata
aaggatggcattaatccgcaccagacaaagcatttaatctatgcgctctgtcgctgggaa
gagcatctggccacacaaataatcagcatgcttttcgcctctgtcacaaagcacaccgaa
ttgtgtacgcccttctttaagctgttaaccctattgactgagacccaaggcgggccagtg
gggctgccctgtttcacccagcttatactgccacggatgtgggatgccgccgaatactgc
ccacaatcggttctcgattggctctcgctgcaagccaccaagaacaaaattgcccatgcc
tggattttgcaatccgctgaacagtgggtagagcaatttctgcttgcccatgacaatacg
cgcgttcgaaatgctgccgcttgtctgttggttgctcttgtgccatcgcagcccttccgt
gccaattttagagcgcattcgcagcataaattattggccctcaatccgcatagctatcgg
gacattaacaccgatgcccaagcagtgctccatcaggttatcactttgcttttgagactg
ctgcgtccagctcgagtttatgcggatattggtgcccatggtaccacaaagctgactgct
tacttcaatctgctcagctattgtatggtttcaaagactgaaaaactaatgataggatcg
ttcatgcgttccttgtgggaattatttcatccgcgactttcggaacccagtgtaccggct
catcataacaaacatgcgctgctcaccttttggcatcattcgctagttgattgcccggag
aatgcagcactggtggccaattgcccggagataacaaggaatattgcatttaactacata
ttggctgatcatgatgatgctgaaattgttacctacaatcgttccatgttgccggcttac
tatggattgttgcgtctgtgctgtgaacaaagtcgcgctctcacacgacaattgtcccaa
catcagaatcttcaatgggctttcaagaacattactccgcatcccactcaatatgcggca
gctgttgatgagctattcaagctgatggcattgtttgccactcgtcatccggatgccagc
gagcaggagaaactcgatgtcactcaatttaggcgggcagtaattatgtcctacacaagt
agtctggatgctagagtatcgtggtcgacactaatcagtgcattgaaaatactggtggac
aacgaggatgatcgcatgttggtcatatttaacggaggcattgaaatgtgctgtgaggct
ctgcatacactacattccatgcatcatgaggctactgcctgccatgtggcaggggatcta
tttgatttgcttggcgaaatgatgctgctgttggccacattgcgcacacgcaccgacagt
cccgcccagaagaagcaacagctggaacagcaattgcaattgcagcagcaacagcttctg
caaaaacagcaacagacgcagtgcacccaaaccccacagacaccacaccagaaggaaaaa
caattgcaacagcaaatgcagcagcatttgcagctgcagcaactgcaacaaatgcaattt
cagcaacagcatttcttacgccaacaacatcaacactctgccttggccaaagctttgccg
gatgccatcaaacgtctggccacactcctcaacacattcaactcgccagagattagtcgc
atgacattggaggtactcaaagagctggtgcgaaacacaagtctggaagccactagcatt
ttagcccccattctgataaactgccatttgtcagtggccaatgccccgaatgccattgga
ccattgggtccatactttccacgtcgtggagccaagcaccagcacacaccttggccattg
ggttccaagaattcacctcggccaccaagaccaatggtgcagatgtccatagccttgtcc
gaacttacgccgctcggcctagacgtcgattatgatgcgcaagtagaggcattttacagg
ccatatcatgactttattgatgtaatgatgcgcatgtgcgtcaatactggcacattaaac
gatactctcgtcaaattgcactgcctggtggccattgaatcaaccccattgcacttcaac
tactttcctaagttctgggtgggcatccacaacaatgccctaacgcacaaatactctgag
ctcctggtgaagaatcaacttttggttgagtatctgcacaatgtacttagggatgagaga
agcatgctgaaggacgcctgcgtgcgggaatttctcgagctctattatcacaaggtggca
gctcaacttcctgtggcacgcatgatctacacaataaactatggcatgcactctaaggat
gacattgatgaactgtgcggcgatctgtttgctatcaggataattgcccaggcaacaggt
gtgccagcatcagtgcgcaaagagctccgtggatcgttaagagcattgcagaataagggt
gaacgctttcgaaaggaaacagagcgggatcaactgccaaataagaagcagaagcgtgaa
tccggcagggaaaaggataatgaacagaccaaagggggggcggcagccgaggatgaaaaa
agtgagactgtggcgggtgaaactacatctttaattgagacagcgaaacctacggatgtg
tccatggaagtgtctagtgatgccaatacggataccattatcaaaccaccaacaccctct
ggcagtgaagatgatcaaatggagagcacctcatcggaaaggttagagaaaacctcgctg
ccctcatccgatgatgaaaccgagttggaggatgaattggagcccacgcctaagcgtaac
aaaaagtctataagcaaaaagacagcccaggatcggatcaacgaggatcgtgaaaagcga
ttgaccacactgataaccatggaatcctacattcaaagcattttcaccatcatgaaacgt
gaacctggtgccgcccctagcacgtcaacaacctgcaaagatcaggcggacgagcaatca
ctggagacagcctctacatcggctgctgcgtcagccaaggccaggccaaaaggtgcttac
actccacctgaaccaatgccggaagaaattgatccgaaatcctgcagcatggaattggaa
tcgatgttttgtcggcgaacagaaaacgatacgtccgaatatgagacgacatcgcaacca
ttgcgaccatcaccaccgcagtcgccaacagccacagtatctaatggtagtcagccaacg
gaatcgccgccagctgttgttgttgatatggctgcccccgtcgttgcgtccacgtcccag
gcggcaagtccgacacaaatctag

DBGET integrated database retrieval system