KEGG   Drosophila willistoni: Dwil_GK12154Help
Entry
Dwil_GK12154      CDS       T01067                                 

Definition
GK12154 gene product from transcript GK12154-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dwil_GK12154
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dwil_GK12154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 141 aa AA seqDB search
MKAFIVLAALAAIAAPALGRTMDRCSLAREMSDLGVPRDQLDKWTCIAEHESSYRTGVVG
PENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLSDDITSSVRCAQKVLSQQG
WSAWSTWHYCNGWLPSIDDCF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttttggctgctttggctgctattgccgctcctgctctgggtcgc
accatggaccgttgctccttggcccgcgaaatgtccgatttgggtgtgccccgcgatcag
ttggacaaatggacttgcattgccgagcacgagagctcctaccgcactggcgtcgtcggc
cccgagaactacaatggctccaatgactatggtatcttccagatcaatgactactactgg
tgcgctcctcccagtggtcgcttctcctacaacgagtgcggcctgagctgcaatgccctg
ttgagcgatgacattaccagttcggttcgttgtgcccagaaggtccttagccagcaggga
tggtccgcctggtccacctggcactactgcaacggatggttgccatccattgatgattgc
ttctaa

DBGET integrated database retrieval system