KEGG   Drosophila willistoni: Dwil_GK12180Help
Entry
Dwil_GK12180      CDS       T01067                                 

Definition
GK12180 gene product from transcript GK12180-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
dwi  Drosophila willistoni
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dwil_GK12180
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dwil_GK12180
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK12180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 925 aa AA seqDB search
MAHTKKLYLSKNMEDLEQLTIIPDCCNKSMRILLNTAQKLYTTAEKHRLDGDEEMAYVAY
MKYFNILNDIRKKPDYPNNKAAVREKLGDKEANRRKMDALEKINDSLRDRYRALRQVATP
PTITSSPLDHIGDTVISNGAILSSSSPKEYAQLGIISCESLFQRMQEKTVLVMDCRSIAD
YENSHLTYNWAFNVPEEIISSGMSAGRLQARLSSQSKALWASRSVKETVVLMDWNTKDAE
PASNTAIAILLDILKNWDPDVTYRAPIQILESGYEYFIMMYPSHCTNPSVQAPKQNNNDI
EPIDDIEYPSLSDITMKEDITSYAPGGRPRINRASKLAAMRTMNLVSNEVKSEQAKPIDE
ILRDQANLLQRAEHNDQLLIDANRKWNTIFELKQLQAEGVELSPSDQELLYNILQLENTA
EDYKIENNHLREDLNRYKEEQAIKKTTPNGETEATRCIESKILERQRLDEKHAHDRIERE
RLLAIARETKKLYNPPSIMSSTITPPPPPPPPPANDTTIIPSLDHDSIVDMQNIKNGLGT
LLIEQAAELPRFDRGMKPPSSTQIVKPVEKSQPLVRDFSPVIGHNVGRGLTGLKNLGNTC
YMNSILQCLSHTPQLTEYCITDKYKNYISRSNKTNGQVIEEVAALIKELWNGQYKCVASR
DLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLNVKQKRETITASEKAWMEFTK
AKESLILHLFYGQMKSTVKCVTCNRESATYECFSNLSLELPENKELCYLNQCMDMYFSGE
RIHGWNCPNCKTKREAIKKLDISKLPPVLVVHLKRFHADPIQSGAYTKKQNYLRFPLENL
EMTPYIARAESRTVTPKIYQLYAVSNHYGTMEGGHYTAFCKSANYKRWYKFDDQIVSTLD
TSSVVSSAAYILFYTWLPHTQVSSH
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcccatacaaagaaattgtatttgtccaaaaacatggaagacctggagcaactgacc
atcattccagattgctgtaacaaaagcatgagaattctacttaacaccgcccaaaaactg
tacacgacagcggagaagcaccgtctagacggggacgaggagatggcttatgtcgcatac
atgaaatactttaatatactgaacgacatacgaaagaaacccgactatccaaataataag
gcagcagtacgagagaaacttggtgataaagaagcaaaccgtcgcaaaatggatgctctt
gagaagatcaacgattcgcttagggatcggtacagggctctacgacaagtagccacacca
ccaactataactagtagtcctttggatcacattggcgacacagtcattagtaatggagca
atattgtcgtcatcatcccccaaagagtatgcccaattgggcattattagttgtgagtcg
ttgttccaacgaatgcaggaaaaaacggttctggttatggactgtcgctctattgcggac
tatgaaaactctcaccttacctacaattgggcatttaatgtacccgaagaaataatatct
tcaggcatgtcagctggtagattacaagcacgacttagtagccaatccaaagcactttgg
gcatcacgttccgttaaggagacagtggtgttaatggactggaacacaaaggatgctgag
ccggcatcaaatacggctattgccatattacttgatattttaaagaattgggatccggat
gtcacctatcgtgcacccatacaaattcttgaaagtggctatgaatactttataatgatg
tatcccagtcattgcaccaatccgtctgtacaggcgccaaaacaaaataataacgacatt
gagccaattgacgatattgaatatccatcgctaagtgatataactatgaaagaagacatc
acatcatatgctccaggtggacgacctcggatcaatcgtgctagtaaattggctgccatg
cgcaccatgaatctggtctcgaatgaagtgaaatcggagcaggctaagcccattgatgaa
atattgcgtgatcaggccaatttactgcagcgcgccgagcacaatgatcaattgcttata
gacgcgaataggaaatggaatacaatatttgaattaaaacaactgcaggccgagggagtt
gaattaagtccgagtgatcaggaattgctttacaatatacttcaacttgaaaatacagcc
gaggattataaaattgaaaacaatcatctgcgtgaggatttaaaccggtataaggaggaa
caggccatcaaaaagacaacaccaaatggcgaaactgaggccaccagatgcattgaatcc
aagatacttgaacgtcaaaggctcgatgaaaagcatgcccatgatcgcatagaacgtgaa
cgactcctggcgattgcccgtgagaccaaaaaactgtataatccgccctcgataatgtca
tcaacaatcacaccgccaccaccgccgccgcccccgccggcaaacgatacaacaataatt
ccaagtctagatcatgattcgattgttgatatgcaaaacattaaaaatggcttaggaact
ctactgatcgagcaggcagcggagttaccacgatttgataggggcatgaaaccgccatca
agcacccaaatagtaaaaccagtggaaaaatcacagcccctggtgcgggacttttcacct
gttataggtcacaatgtgggtcgtggtttaactggattgaaaaatctgggcaacacttgc
tatatgaatagcatactccaatgcttgagtcatacgccacagttgacggaatattgtatt
acggataaatacaagaactatataagtcgtagtaacaaaactaatgggcaagtaatcgaa
gaagtcgctgcattaattaaagaactatggaatggtcaatataaatgtgtggctagtcgt
gatttaagatatgttgttggacagtatcagaaaatctttcgtggcgtcgatcaacaggat
tctcatgaattccttacaattttaatggattggttacattccgatttgcaaactttgaat
gtgaaacaaaagcgagaaacaatcacagcctcagagaaggcttggatggaatttaccaag
gcaaaggagagccttatattgcatttgttctatggacaaatgaagagcacagtaaaatgt
gtaacctgtaatcgcgaatcagccacatatgaatgtttctcaaatctcagtttggaattg
ccagaaaataaagaactttgctatttaaatcaatgcatggacatgtattttagtggtgag
cgtatacatggttggaattgtccgaattgcaaaacgaaaagagaagcgattaagaaattg
gatatatcgaaattgccaccagttctggtggtgcatttaaaacgttttcatgcggatccc
atccagagcggagcttatactaagaagcaaaactatttgcgttttcctcttgaaaatctt
gagatgactccctatatagcgcgcgctgaatctcgtacggtaactccaaaaatctatcaa
ctatatgcagtatccaatcattatggcaccatggaaggtggccattatacagccttctgt
aagagtgccaattataaacgttggtataaatttgatgatcaaattgtttcgacgctggat
acgtcgagtgttgtctcaagtgcggcgtacattctgttctatacttggttgccacatacg
caagtatcatctcattaa

DBGET integrated database retrieval system