KEGG   Drosophila willistoni: Dwil_GK12260Help
Entry
Dwil_GK12260      CDS       T01067                                 

Definition
GK12260 gene product from transcript GK12260-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 141 aa AA seqDB search
MKAFIVLAALAAIAAPALGRTMDRCSLAREMSDLGVPRDQLDKWTCIAEHESSYRTGVVG
PENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLSDDITSSVRCAQKVLSQQG
WSAWSTWHYCNGWLPSIDDCF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatcgttttggctgctttggctgctattgccgccccagctctgggtcgc
accatggaccgttgctccttggcccgcgagatgtccgatttgggtgtgccccgcgatcag
ttggacaaatggacttgcattgccgagcacgagagctcctaccgcactggcgtcgtcggc
cctgagaactacaatggctccaatgactatggtatcttccagatcaatgactactactgg
tgcgctcctcccagtggtcgcttctcctacaacgagtgcggcctgagctgcaatgccctg
ttgagcgatgacattaccagctcggttcgttgtgcccagaaggtccttagccagcaggga
tggtccgcctggtccacgtggcactactgcaacggatggttgccatccattgatgattgc
ttctaa

DBGET integrated database retrieval system