KEGG   Drosophila willistoni: Dwil_GK12320Help
Entry
Dwil_GK12320      CDS       T01067                                 

Definition
(RefSeq) GK12320 gene product from transcript GK12320-RA
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dwi  Drosophila willistoni
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dwil_GK12320
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     Dwil_GK12320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 695 aa AA seqDB search
MNQSHEKNSSSDGTSSMGSTPIATITATPTPTSNAVVVATGTADGDGESNHRHDVSDTFY
TSQRKKGSSHVFRVRLDTTGFTLQRESPTGTTIKEQTVKICDIVGARCMRLKKTRRLAMA
NACACSSGNPNSPANSATSRSNNRNNGATPSKCSTASKEEYACDGDVSAYLYVFAYVLKK
KSLRSELHRERTVLTLRFRSFDSFEDNMREADRWYRALRWQLHQTLEDIFVDRTNEERRR
RVLVLLNPKSGSGNGREVFNMHVSPVLNEAEVPYDLYVTKHSNFASELMSTRRLDAWCCV
VAVGGDGLFHEIVNGLMQREDWEQVLPNIALGIIPCGSGNGLARSIAHGYNEPYFSKPVL
GAALTVISGRSSPMDVVRVQLKERSVYSFLSIGWGFISDVDIESERLRMFGYQRFTIWTL
YRLANLRTYNGRVSYLPSHQTGQGVGGLEGMQEPTLRMLQSSRSYNTTLNKQQLLNVPAS
FHHSVECLPSEFADVISLETSINQSFRSRCDSWLSGGSRRSYYYSISESIYHSLADESDL
AEQSQIYAASSYLENRPQNFGPPSSLPDLDQPLSPEDGWQVEEGEFIMMHAVYQTHLGID
CHFAPKAQMNDGTIHLILIRGGISRPHLLSFLYNMSSGTHLPEVNNQYVKVLPVRAFRLE
PHDNHGIITIDGERVEFGPLQAEVLPGIARVMVPK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatctcatgagaagaacagcagcagcgacggcacaagttccatgggctcgacg
ccaatcgccacaatcactgccactcccacacctacttccaatgctgttgttgtggccacg
ggcacggccgatggcgatggtgagagtaatcatcgtcacgatgtcagcgacactttctac
actagtcaacggaaaaagggcagcagccacgtattccgtgtgcgtctagacaccactgga
ttcacactgcagcgggagtcacccactggcaccaccatcaaagagcaaaccgtgaaaata
tgcgatattgttggagccagatgcatgcggctaaagaagacccgtcgcctggccatggcc
aatgcctgtgcctgcagcagcggaaatcccaattcgccggcaaattcggcaaccagccga
agcaacaatcgtaacaatggggccacaccaagcaagtgcagcacagccagcaaggaggaa
tacgcctgcgatggcgatgtcagtgcatatctctatgtctttgcctacgtcctgaaaaag
aaaagtttgcgtagcgagcttcatagagagcgcacggtattgactctgcgttttcgttcc
tttgactccttcgaggataatatgcgggaggcggatcgctggtatcgcgcattgcgctgg
caactgcatcaaacgcttgaggatatttttgtggaccgcaccaatgaagagcgtcgtcgt
cgtgttttagtgctgcttaatcccaaatccgggtcgggcaatggccgtgaagtctttaat
atgcatgtctctccagtgttaaatgaggctgaagtgccttacgatctgtatgtaacgaaa
cattccaattttgccagtgaactgatgagtacacgtcgcctggatgcatggtgctgtgtg
gtggctgtcggaggtgatggactcttccatgagattgtcaatggtctgatgcagcgtgaa
gattgggagcaagtgttgcccaatatagctttgggcattatcccctgcggttctggcaat
ggtctagcacgctccatagcccatggatacaacgaaccctattttagtaagccagttttg
ggtgctgctttgactgtcatcagtggccgcagttcacccatggatgtggtacgtgttcag
cttaaggagcgctccgtttactcctttctctccattggctggggcttcatctcagatgtg
gacattgagagcgaacgcctacgcatgtttggctatcaacgctttaccatttggacgctt
tatcgtctggcaaatctgcgaacttataatggccgagttagctatttgccgagccatcaa
acgggccagggagtcgggggtctggaaggaatgcaggagccaacacttaggatgttgcaa
tccagtcgaagctataataccaccctcaataagcaacagttgttaaatgtgccagcaagc
tttcatcattccgttgaatgtttgccatcagagtttgccgatgtcatttcgctggagacc
tccatcaatcaatcctttcgttcacgctgcgatagttggctgtcggggggatcgcgacgt
agttactactattccatatcagagagcatctatcatagtttagccgatgaaagtgatttg
gccgaacagtcacagatttatgcggcatcatcctacttggaaaatcgtccgcagaatttc
ggccctcccagcagtttaccggatctggatcaaccgctgtccccagaagatggttggcag
gtcgaggaaggtgaattcataatgatgcatgctgtctatcaaacgcatctgggtatcgat
tgccattttgcacccaaggcccaaatgaacgatggcaccattcatcttattcttatacgc
ggtggcataagtcgtccccatttattgagctttctctacaacatgagctccggcacacat
ttgcctgaggtgaataatcagtatgtcaaggttttgcccgtaagagcctttcgtttggaa
ccccacgataatcatggcatcatcactatcgatggtgagcgcgttgaatttggcccgcta
caggcggaagtgttgccgggcatagcccgagtcatggtgcccaagtag

DBGET integrated database retrieval system