KEGG   Drosophila willistoni: Dwil_GK12444Help
Entry
Dwil_GK12444      CDS       T01067                                 

Definition
GK12444 gene product from transcript GK12444-RA
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dwi  Drosophila willistoni
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dwil_GK12444
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dwil_GK12444
   04391 Hippo signaling pathway -fly
    Dwil_GK12444
   04068 FoxO signaling pathway
    Dwil_GK12444
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dwil_GK12444
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dwil_GK12444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 371 aa AA seqDB search
MAVQHQHYTVEVGDTNFTILGRYINLRPIGSGAQGIVCAAYDTVTEQNVAIKKLSRPFQN
VTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDL
DHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMT
PYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGT
PSPSFMQRLQPTVRNYVENRPRYAGYAFDRLFPDGLFPTDNNQNSRRKAADARDLLSKML
VIDPEQRISVDKALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMD
YEAHNTINRTR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaacatcaacattataccgttgaagtaggagacaccaattttactattctt
ggtcggtacataaacttaaggccaattgggtctggtgcacaaggtatagtatgtgctgct
tatgatacggtaactgaacaaaacgttgcaattaaaaaactatcccgaccattccaaaat
gtaactcatgcaaagcgagcttatagggaatttaagcttatgaaactcgtaaatcacaaa
aatatcattggattacttaatgcctttactcctcaacgcaatttggaagaatttcaggat
gtgtacctcgtaatggagctgatggatgccaatctttgtcaagtgattcaaatggatttg
gatcatgatagaatgtcatatttgctttatcaaatgctttgtggaataaaacatttgcac
tcggctggaattattcatagagacttaaaaccatctaacatagttgtaaaagcagactgt
accttaaaaattttggacttcggtcttgcacgaacagctggtaccactttcatgatgact
ccatatgttgtaactcgctattatagggcgcccgaagttattttgggaatgggctataca
gaaaacgttgatatttggtcagttgggtgtattatgggagaaatgataagaggaggcgtt
ctattccctggcactgatcacatagatcaatggaataaaataattgaacaactgggcact
ccttctccatcatttatgcaacgcttgcagccaaccgttcggaattatgtagaaaatcgg
ccaagatacgctggttatgcatttgatagactttttccagacggattgttccctactgat
aacaaccagaatagtcgaagaaaagctgctgacgccagggatcttttaagcaaaatgctg
gtgattgatccagaacaacggatatctgtagacaaggctttgaagcacgaatacattaac
gtgtggtatgatgccgaagaagtagatgctccagctccagagccgtatgatcacagtgta
gatgagagagagcataccgttgaacaatggaaagagttaatttatgaggaagtaatggat
tatgaagcacataacacaattaatagaacacgatag

DBGET integrated database retrieval system