KEGG   Drosophila willistoni: Dwil_GK12497Help
Entry
Dwil_GK12497      CDS       T01067                                 

Definition
GK12497 gene product from transcript GK12497-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dwi  Drosophila willistoni
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dwil_GK12497
Enzymes [BR:dwi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dwil_GK12497
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C44
   Dwil_GK12497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 561 aa AA seqDB search
MCGILAIFSSNGQSVQPRRILNSEHSLRELAYRLSGKQRHRGPDDTGVAVVESQGVALMH
ERLSVIGVETGHQPLYSEDGSIMLIANGEIYNYLELAKDIAQERGGYQPKSDSNVIIELY
EKYGKDLLNHITGMFTFVLYDKKKRELLVARDPFGIIPLYMGQDDAGNLMFASEMKCLIG
ICPQLKIFPPGHFIQGQVKLESETRRYYDPIWRHGTPTQPVDLSELRMQLERAVRSHLQC
DVQFGALLSGGLDSSLIASIATNVMREKDPKYRLHTFSVGMIGSPDFEHARMVARHINSH
HTEIAFTVDDCLDGVRDLIYHLESYDISTVRCSLPMFYLARYVKSTGIKMILSGEGADEI
FGGYLYFHQAPNYEEFHQEMVNRCEQLHVSDILRANKVTMSKGLELRVPFLDTAFVNYVM
GIRPQDKIPGSLNEFDGVREKRIEKFILRKAFVQNYLPDAVLWRQKEQFSDGVGYDLIDA
LPKFAARHVSDDQLLEAVKRFPINPPKTKEAFYYRCIFEEQFPGEAAARTVEKWTPRMDW
GCPEDPSGRAQKAHDKSYGKC
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttggccattttttcgtccaatggccagtccgtacaaccacgccgtatc
ctgaacagtgagcatagtttacgggaattggcctatcgcctgagtggaaagcaacgccat
cgaggccctgacgacactggtgtggcggttgttgagagtcagggcgtggctttaatgcac
gaacgcctctcggtgattggcgtcgagacgggtcatcagccactgtactctgaggatggt
tccattatgttgatagccaatggcgagatttacaactatctcgaactggccaaggatata
gcccaggagcgtgggggctatcaaccgaagagtgacagcaatgtgatcattgaattgtat
gagaagtatggcaaggatttgcttaatcacatcactggcatgttcacgttcgttctgtac
gataagaagaaacgggaattgctagtggcccgcgatccctttggcattatccccctttat
atgggccaggacgatgcgggtaatcttatgtttgcctctgaaatgaaatgtttgatagga
atttgcccacaactgaagatttttccacctggccactttatccagggccaggtgaaactt
gaatcagagaccagacgctactatgatccaatttggaggcatggcacaccaactcagcca
gtcgacttgagcgaactaagaatgcaactggagcgggctgttcgatcgcatttgcaatgc
gatgttcagtttggagctttgctgtcaggtggcttggattccagtttgatagcatcgata
gccacgaatgtaatgcgggaaaaggatccaaagtaccgtttgcatacattctctgtgggt
atgatagggtctccggactttgagcatgctcgcatggtggcccgtcatataaatagccac
cacactgagattgcctttaccgttgacgattgcctggacggagtgcgagatttgatttat
catttggagtcctatgacatatccactgtacgctgcagccttcccatgttctatttggcc
agatatgtaaagagcaccggcatcaaaatgatactatctggcgagggagccgatgagata
tttggtggctatctctacttccatcaagcgcccaattatgaggagttccatcaggaaatg
gtcaatcggtgtgagcaactccatgtctccgacattttgcgggccaacaaggtaaccatg
tccaagggtctagagctgcgagtcccattcctagacacagcgtttgtcaactatgtgatg
ggtatacgtccgcaggataaaattccagggtccctcaatgaatttgatggtgtgcgagag
aagcgcatcgagaagtttattttgcgtaaggcttttgtccaaaactatctaccagatgca
gtactttggaggcaaaaggaacagttctccgatggcgtgggctacgatcttatcgatgcc
ctacccaagttcgctgcacgtcacgtgagcgacgatcaacttctagaggctgtgaaacgt
tttcccattaatcctccaaaaacaaaagaagctttctattatcgctgcatattcgaggag
cagtttccgggtgaagcagctgctagaactgtggagaaatggacaccgcgcatggattgg
ggttgtcctgaagatccgtcgggtcgtgcccaaaaggcacatgataaatcctatggcaag
tgctag

DBGET integrated database retrieval system