KEGG   Drosophila willistoni: Dwil_GK12505Help
Entry
Dwil_GK12505      CDS       T01067                                 

Definition
GK12505 gene product from transcript GK12505-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 641 aa AA seqDB search
MTSKANCRLPFPYVVASLDLPSNGRRPLDELAKQANLPFIYEQCHVLEAQQFTLEPVYVA
IFSTELPKPKLIAAKWSPQILPNKQMLLASLNSHGVFLLLTKPSECTRWKELNGLDVAVH
LRDVLQKPYKVNPSEINNFQDYQHFIDRSWITIMAWGPTKLRLFSHTLILGTASGHIWVL
SLSPDGGRLLDHWQMQTDLNRICFLQVFQDLLLVGDVNGLVNLYNFASASLELTLVKNLW
LKSDRMGIQQAEITHCRNRNCTYITFCKGAHLLTWCEQSDGNWLETRFYVGGMKITALAG
ITSNSYILATAQSKIYKIQVVHKSNNHLSLTMKPLQIKSCENYQILGLFNSRHKNLYTAV
LSPKKEYLQTTSKLRNKLHLHVGSIHQRDPLIQLAANLKLHEPINSSADLLAEVRLTLFF
KKSMQKYLNFSSLEYLQFHQRATEAQLQHLQLVYHILTPIYEMQTKIFQYSCRNENTKCR
LDLLLAMLTTTHMRLRLQYLASLSAKDLTPFQILASQKMFKEFARLKRKLQINLNAEEHP
DDIITRHFLDQMDIHFEDLREQLNVKAEKDEQHIQLGQSLLLCSISYVEMPLSLDRCYCT
LCSRPILMNKQNLEQLYENGPKILIFCPFCHGSYKYDLVNS
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcaaggcgaattgccggcttccctttccctatgttgtcgcgagtttggattta
cccagcaatggacgcagacccttagatgagttggccaaacaggcaaatctcccatttatt
tacgaacagtgccatgtcctggaagctcagcagtttaccttggagcccgtctatgtggca
atcttctcgacagaattaccaaaacctaaactgatagcagccaaatggtcaccacagata
ttgcccaataaacaaatgcttttggcctctctcaatagccatggagtattcctgttgctc
actaaaccgtcagaatgtactcgctggaaggaactaaatggtcttgatgtggcagtccac
ctaagagacgttctgcagaaaccctataaggtgaatccttcagagataaacaattttcaa
gattatcaacattttatagatcgcagttggatcaccataatggcctggggtccaaccaaa
ttgcgtttattcagtcacactcttatattgggtactgcaagtgggcacatttgggtgctt
agtctgtctccagatggtgggcgtcttttggatcactggcagatgcagacggatttgaat
cgcatttgctttctgcaagtattccaggatctgctattagttggtgatgtcaatggtctg
gttaatctatataatttcgcctccgcctcgctggaattgacattggttaagaatctttgg
ctgaaatcagatcgcatgggtatacagcaagctgagataacccattgcagaaatagaaat
tgcacctacataacattttgtaagggagcacatctgctcacctggtgtgaacagagcgat
ggcaattggctagagacacgtttctatgtgggcggcatgaagataacagctcttgcggga
ataaccagcaacagctacatcttagccacggctcagagtaaaatctataaaattcaagtg
gttcacaagtccaacaatcatttgtctcttaccatgaaacctctgcagataaaaagctgt
gaaaattatcaaatactcgggctattcaatagtcgacataagaatctgtatacggcagtc
ctttcaccgaaaaaggagtacttgcaaaccacttcgaaattgcgaaataaattgcatcta
catgtgggcagcatacatcagcgtgatcccctgattcagctcgctgccaatctaaaactc
catgagcccatcaattcctcagccgatctgctggctgaggttcgcctcactttgttcttc
aagaagagtatgcaaaaatatttaaattttagttcgctcgagtatttgcaattccatcaa
agggccacagaggcacagctgcagcatttacaattggtctatcatatcctaacacccatt
tatgaaatgcaaacaaaaatatttcaatattcctgccgtaatgagaacacaaaatgccga
ttggatttgctacttgccatgttgaccacaactcatatgcgtttgagactacagtatttg
gccagtttaagtgcgaaggatctaaccccattccaaatactagccagccaaaaaatgttt
aaagaatttgcacgtttgaagcggaaattgcaaatcaatctgaatgccgaggaacatcca
gatgatatcataacgcgacactttcttgatcaaatggatatacattttgaagatctgcga
gaacagctcaatgttaaagcggaaaaggatgagcaacatattcagctggggcagtcttta
ctcctttgtagcatatcctatgttgagatgccccttagtctggatcgttgctattgcact
ttgtgttcacgcccaatcttgatgaacaagcagaatcttgaacaactttatgaaaacgga
ccaaaaatcttaatcttttgtccattctgtcatggcagctataaatacgatttagtaaat
tcatga

DBGET integrated database retrieval system