KEGG   Drosophila willistoni: Dwil_GK12505Help
Entry
Dwil_GK12505      CDS       T01067                                 

Definition
(RefSeq) GK12505 gene product from transcript GK12505-RA
  KO
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dwil_GK12505
Transcription machinery [BR:dwi03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dwil_GK12505
Chromosome [BR:dwi03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dwil_GK12505
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 704 aa AA seqDB search
MPRATDTDIGEDHLIDENGGALRFRTFYRGSVKQNSVHEFLSSTTDGDNIALLGSTTSLV
TLEMTSKANCRLPFPYVVASLDLPSNGRRPLDELAKQANLPFIYEQCHVLEAQQFTLEPV
YVAIFSTELPKPKLIAAKWSPQILPNKQMLLASLNSHGVFLLLTKPSECTRWKELNGLDV
AVHLRDVLQKPYKVNPSEINNFQDYQHFIDRSWITIMAWGPTKLRLFSHTLILGTASGHI
WVLSLSPDGGRLLDHWQMQTDLNRICFLQVFQDLLLVGDVNGLVNLYNFASASLELTLVK
NLWLKSDRMGIQQAEITHCRNRNCTYITFCKGAHLLTWCEQSDGNWLETRFYVGGMKITA
LAGITSNSYILATAQSKIYKIQVVHKSNNHLSLTMKPLQIKSCENYQILGLFNSRHKNLY
TAVLSPKKEYLQTTSKLRNKLHLHVGSIHQRDPLIQLAANLKLHEPINSSADLLAEVRLT
LFFKKSMQKYLNFSSLEYLQFHQRATEAQLQHLQLVYHILTPIYEMQTKIFQYSCRNENT
KCRLDLLLAMLTTTHMRLRLQYLASLSAKDLTPFQILASQKMFKEFARLKRKLQINLNAE
EHPDDIITRHFLDQMDIHFEDLREQLNVKAEKDEQHIQLGQSLLLCSISYVEMPLSLDRC
YCTLCSRPILMNKQNLEQLYENGPKILIFCPFCHGSYKYDLVNS
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagctactgacaccgacatcggggaggaccatcttatagacgagaatggtggc
gccttaagatttcgcactttttaccgaggaagtgtaaaacaaaattcggtccatgaattt
ctatcgtctaccacggatggtgacaatattgccctcctgggatcgacaacgtccctcgtt
accctggagatgacgagcaaggcgaattgccggcttccctttccctatgttgtcgcgagt
ttggatttacccagcaatggacgcagacccttagatgagttggccaaacaggcaaatctc
ccatttatttacgaacagtgccatgtcctggaagctcagcagtttaccttggagcccgtc
tatgtggcaatcttctcgacagaattaccaaaacctaaactgatagcagccaaatggtca
ccacagatattgcccaataaacaaatgcttttggcctctctcaatagccatggagtattc
ctgttgctcactaaaccgtcagaatgtactcgctggaaggaactaaatggtcttgatgtg
gcagtccacctaagagacgttctgcagaaaccctataaggtgaatccttcagagataaac
aattttcaagattatcaacattttatagatcgcagttggatcaccataatggcctggggt
ccaaccaaattgcgtttattcagtcacactcttatattgggtactgcaagtgggcacatt
tgggtgcttagtctgtctccagatggtgggcgtcttttggatcactggcagatgcagacg
gatttgaatcgcatttgctttctgcaagtattccaggatctgctattagttggtgatgtc
aatggtctggttaatctatataatttcgcctccgcctcgctggaattgacattggttaag
aatctttggctgaaatcagatcgcatgggtatacagcaagctgagataacccattgcaga
aatagaaattgcacctacataacattttgtaagggagcacatctgctcacctggtgtgaa
cagagcgatggcaattggctagagacacgtttctatgtgggcggcatgaagataacagct
cttgcgggaataaccagcaacagctacatcttagccacggctcagagtaaaatctataaa
attcaagtggttcacaagtccaacaatcatttgtctcttaccatgaaacctctgcagata
aaaagctgtgaaaattatcaaatactcgggctattcaatagtcgacataagaatctgtat
acggcagtcctttcaccgaaaaaggagtacttgcaaaccacttcgaaattgcgaaataaa
ttgcatctacatgtgggcagcatacatcagcgtgatcccctgattcagctcgctgccaat
ctaaaactccatgagcccatcaattcctcagccgatctgctggctgaggttcgcctcact
ttgttcttcaagaagagtatgcaaaaatatttaaattttagttcgctcgagtatttgcaa
ttccatcaaagggccacagaggcacagctgcagcatttacaattggtctatcatatccta
acacccatttatgaaatgcaaacaaaaatatttcaatattcctgccgtaatgagaacaca
aaatgccgattggatttgctacttgccatgttgaccacaactcatatgcgtttgagacta
cagtatttggccagtttaagtgcgaaggatctaaccccattccaaatactagccagccaa
aaaatgtttaaagaatttgcacgtttgaagcggaaattgcaaatcaatctgaatgccgag
gaacatccagatgatatcataacgcgacactttcttgatcaaatggatatacattttgaa
gatctgcgagaacagctcaatgttaaagcggaaaaggatgagcaacatattcagctgggg
cagtctttactcctttgtagcatatcctatgttgagatgccccttagtctggatcgttgc
tattgcactttgtgttcacgcccaatcttgatgaacaagcagaatcttgaacaactttat
gaaaacggaccaaaaatcttaatcttttgtccattctgtcatggcagctataaatacgat
ttagtaaattcatga

DBGET integrated database retrieval system