KEGG   Drosophila willistoni: Dwil_GK12526Help
Entry
Dwil_GK12526      CDS       T01067                                 

Definition
GK12526 gene product from transcript GK12526-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK12526
   00053 Ascorbate and aldarate metabolism
    Dwil_GK12526
   00500 Starch and sucrose metabolism
    Dwil_GK12526
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dwil_GK12526
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK12526
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK12526
   00982 Drug metabolism - cytochrome P450
    Dwil_GK12526
   00983 Drug metabolism - other enzymes
    Dwil_GK12526
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dwil_GK12526
Glycosyltransferases [BR:dwi01003]
 Others
  Hydrophobic molecule
   Dwil_GK12526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 646 aa AA seqDB search
MRLLQLSFCLMVLFAHSISGANILTILPSVWKSHYLFGRRLLQELATSPANHSVTLISLH
GEENAEVNQLPNIREIRVDGLKENWLDMGMSYEAEDMRAQSVMERFTRLIYAGTTNVDLL
LGDGQVKKLLTSGERFDLLIVDLFLSDALLGMAFYYGVPTVALSPTGANSWLNNMFGNPQ
ASSLDPSQFLAFTERMNTRQRIVNTLMSTFERLTYNFFHLISQQSVYTKHFEPLVKELPQ
YRELTKNLSLALINSHPGLHYPRAYLPNMLEIGGLHLLQEKDLQIPKHLESFMASSPPGG
VIYMSLGADIQTAQLPSEKLAIFLDVFTHLKEFNFLIKWEKDEFLPDYQLPEHIIISNWL
PQQAILAHPQMKLFISSCGQLSVWESIAGLTPILAIPILAEQEVMAKRLQLQGVSLTVNY
EAIAYDALLHGIRQLTLNLTYGQNLKKLNGRLISKNFNPSARAVSQIELILNSAGADYLK
SHANALNFWCAEGIDVLLIITLGFCGILTIPFLAICCILRKSYYSQAAADHAPYRATLKA
VGRVHSYGDGGTCSASVSSEPLRRTRSAQSLSARSSTSSFSSTIPTSSTSTTPMDLTPPP
PGTQSLINEPPLLDMYSINTNPKDGYEVEDEASSSSSSPRLCTMGG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctactgcagttgtctttttgtttaatggtgctatttgcccatagcatctccggt
gccaatattctgaccattttgccaagtgtttggaagagtcattatttatttggacgaaga
ttactgcaagaattggcaaccagtccggcgaatcattcggtgacccttatcagtctgcat
ggcgaagagaatgccgaagttaatcaattgcccaacatacgagagattcgtgtcgacgga
ctcaaagagaattggctggacatgggcatgagctatgaggcagaggatatgcgtgcccaa
agtgttatggagagattcaccagattgatctatgcaggcacaaccaatgtggatttacta
ttgggcgatggtcaagtaaagaaacttcttaccagcggcgagagattcgacttgctaatt
gtcgatttgtttctaagcgatgccctgttgggaatggctttctactatggtgtgcccacg
gtggccctgagtcccactggtgccaattcttggttaaacaatatgtttggcaatcctcaa
gcatcttcactggatcctagccaatttttggcattcacagaacgcatgaatacccgccag
aggatcgtgaatactctaatgagcacctttgagcgattgacctacaatttcttccatttg
atctcccagcaatcagtttatacaaaacactttgagcctctggtcaaggaattgccacaa
tatcgcgaactgactaaaaatcttagtttggctttaattaattcccatcctggcttgcat
tatccaagagcctatttgcccaatatgctggaaattggtggattgcatctcctccaagag
aaagatttgcaaatacccaaacatttagaatcgtttatggcatcatcaccaccgggtggt
gttatctatatgagtcttggtgctgatatacagaccgctcagttgcctagcgaaaaattg
gccatatttttagatgtctttacacacttgaaggaattcaattttctaataaaatgggaa
aaagatgaatttctgcctgactatcaactgcccgaacatataatcattagcaattggttg
ccacagcaggcaatattggctcaccctcagatgaagctctttattagcagctgtggacag
ctaagtgtttgggaatcaatagctggactgacgcccatacttgccatacccatactggcc
gaacaggaggtgatggccaaacgtttacaattgcagggagtctcattgactgtgaactat
gaggcaatagcctatgatgccctactccatggcattaggcaactgactctgaatctaacc
tatggccaaaatctgaaaaagctcaatgggcgtttaataagcaaaaatttcaatccatct
gcccgtgcggtcagtcaaattgagcttatattgaactctgcaggagcagattatctaaaa
tcacatgcgaatgcattaaatttctggtgtgccgagggaatagatgtccttttgattata
acacttggtttttgtggtatcctaactataccattcttagcaatctgctgcattctacga
aaatcgtattatagtcaagcggcagctgatcatgcaccatatagagcgaccctaaaagcg
gtcggtcgagtccatagctatggcgatggaggtacttgttctgcatctgtctcatcggag
ccattgaggagaacacggtcggctcagtcgctgtcggcgcgttcgagtacatccagtttt
agttccacaataccaacatcgagcacttcaacgaccccaatggacttaacaccaccgcca
cctggcacacagagcttaattaatgagccgccacttttggatatgtatagcattaacaca
aatcccaaggatgggtatgaggttgaggacgaggcgagcagcagcagcagcagcccgcgg
ctctgcacaatgggtggatag

  All links  
No link information was found.   
DBGET integrated database retrieval system