KEGG   Drosophila willistoni: Dwil_GK12583Help
Entry
Dwil_GK12583      CDS       T01067                                 

Definition
GK12583 gene product from transcript GK12583-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dwi  Drosophila willistoni
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dwi03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dwi04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 280 aa AA seqDB search
MLVAKQTQVQMRAEDSETDDVLTDSRSRSTSSSGELKSLSDGTEVQQMQAPKDIQLKHPL
EHTWTLWYLENDRSKSWEDMQNEITSFDMVEDFWSLYNHIKPPSEIKIGSDYSLFKKGIL
PMWEDQGNKCGGRWVINMGRCTKLELDKLWLDVLLILIGETFEHSTEICGAVINLRGKTN
KISIWTANGHNEVAVIEIGRKLRDLLGFQAHQLQYQLHKDLMTKQGSPVKAVYVVISALH
RSLNPSMVNKPTDFSLMEIEEQVAGTETCSIDNRYVLCAE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagcaaaacaaacccaggtccagatgcgggcagaagacagtgaaacggatgac
gtgttgaccgattcgcgttcgcgttccaccagctctagtggggagctgaaatcactctcg
gacggtacagaagtgcagcaaatgcaggcaccaaaggacatccaattaaaacacccatta
gagcacacctggacactctggtatctggagaacgatcgctccaagtcctgggaggatatg
caaaatgaaattacaagtttcgacatggtagaggatttctggagtctctacaaccacatt
aagccaccatcggaaataaagattggcagcgactattcgctgttcaaaaagggcatatta
cccatgtgggaagatcagggcaacaagtgtggcggtcgttgggtcataaatatgggtcgc
tgcactaagctggaactggacaagctatggctagatgtgctgttaatactgattggcgag
acctttgagcacagcactgaaatctgcggagcagtcatcaacttgcggggcaagaccaac
aaaatttcgatttggacagccaatgggcacaacgaggtggccgttatagagattggacgc
aaactgcgcgacctactggggttccaggcacatcaactgcaataccaattgcacaaggac
ttgatgaccaagcaaggctcgccggtcaaagccgtttacgtagtgatctcggctttgcac
cgaagccttaatccttccatggtgaacaagccaacagacttttctctaatggaaatagag
gaacaggttgctggcactgaaacttgttcgatagataatcgttatgtcctctgcgccgaa
tga

DBGET integrated database retrieval system