KEGG   Drosophila willistoni: Dwil_GK12618Help
Entry
Dwil_GK12618      CDS       T01067                                 

Definition
GK12618 gene product from transcript GK12618-RA
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dwi04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 833 aa AA seqDB search
MSGGPSITLKSQPIDGSNSGNAAAGQQQQQQPAANGNSGAGAGPGGAAAGGAGGVGQIQA
NGHVTGGAAGGSAPQEGTRQNSLQRIQQRKQKVFSLPIRQKLAKLAMYSACQSDNCRCTG
WKTPQENRHRDVESSYCPEFSEECRNASCRHPLRSHIAHLDGISSSNMDELLGAIIDMEN
LFMSMQRVEDEDTKKVYLYLFRLLRQCVLTRQQAVIRGPLGDPPFESPCITKAVLSLVFY
KYNHLNQSELQTMTEVAKTFLNFLNHYNFESPSARRGDLNHEDASNYKINYTRWLVFCHV
PAFCNSLRQFETSLVFGRTLLRTVFQYMSQQLKKKCISERDRFPEDKRSIITLMPKFLET
LRAELLKDDSPIWDASYRPPNSFVIQQRKRHQQQEINAGNPPGSGSAATHGLSSGSKRTS
VTGEPLHKRAKKETIERCSSESMEDLPTDVVMRAMKSVSESKTTNKAEILFPQNVSRDEN
VKAEEQKRAIEFHVVGNSLAKPVDKQTILWLLGLQLVFAYQLPEMPREYISQLVFDTKHK
TLALIKENQPIGGICFRPFPSQSFTEIVFCAVTMAEQVKGYGTHLMNHLKDYSIQRGIKH
LLTFADCDAIGYFKKQGFSKDIKLARPVYAGFIKEYDSATLMHCELHPSIVNTQFIAVIR
KQSEILKELIAQRHSEVQKVRTGLTCFKEGLPSIPVESIPGLREIGWKPQMRPARSSRPL
EESTDPEKLATSFASVLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKK
GYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtggcccctcaataacgctcaaaagtcaaccaatcgatggcagcaatagcgga
aatgcagctgctggccaacagcagcagcaacaacccgcagctaatggcaacagtggagca
ggagcaggaccaggaggagcagcagcaggaggtgctggaggagttggccaaatccaggcg
aatggtcatgtaacgggtggtgcggccggcggaagtgccccccaagagggtacacgtcaa
aacagcctgcaacgcattcagcagcgaaagcaaaaggttttcagtctacccatacgccaa
aagttggccaagctagccatgtattcggcctgtcaatcggacaactgccgttgcacgggt
tggaagacaccgcaagagaacaggcatcgcgatgtcgagtcctcctactgtccggaattc
agtgaggagtgccgcaacgcgagttgccgccacccgctaagatcgcacattgcccatttg
gatggcatatccagctcgaatatggacgaactattgggtgcaattatcgatatggagaat
ctgttcatgtccatgcaacgggtagaggacgaagataccaagaaggtatatttgtacttg
ttccgattattgcgccaatgcgttctgacgcgccagcaggctgtcattcggggacctttg
ggcgatccaccattcgaatcgccgtgcattaccaaggcggttttgtctttggtcttctac
aagtacaatcatttgaatcaatccgaactccaaaccatgaccgaggtggccaaaactttt
ctcaatttcctcaatcattacaatttcgagtccccatcggcccgtcgtggggatctgaat
catgaagatgcctccaactataagattaactacacccgttggctggtcttctgccatgta
ccggcattttgcaattccctgcgtcaattcgagacatcgctagtctttggacggacccta
ttgcggactgtcttccagtacatgtcgcagcagctgaagaagaaatgcatctccgaacgt
gatcgttttccggaggacaagcgttcgattatcacactaatgcccaaattcttggagacc
ttgagggctgagctgttgaaggatgattcacccatttgggatgccagctataggccgcca
aattcatttgtcatccaacaaagaaagcggcatcagcagcaggagataaacgctgggaat
ccgcctggcagtggatcagcagcaactcatggactgagcagtggcagcaaacggacaagt
gtcacaggcgaaccgctgcataagagggccaaaaaggagacaattgaacgatgtagcagc
gagagcatggaagatctgcccaccgatgtggttatgcgtgcaatgaaatccgtatccgaa
tccaagacgaccaacaaagcggaaattctatttccgcagaatgtctcacgggatgaaaat
gttaaagccgaggagcaaaagcgtgccattgaattccatgtggtgggcaattcgctggcc
aagcctgtggataagcagacgatactttggctccttggactccaattggtctttgcctat
cagttgcccgaaatgccgcgtgaatatatcagtcaattggtgttcgataccaaacacaag
acattggccttaatcaaagagaaccagccaattggtggcatttgctttaggccattccca
tcgcagagcttcaccgaaatcgtcttctgtgctgtgaccatggccgagcaggttaaaggt
tatggcacccatttaatgaatcaccttaaggattatagtattcagcggggcattaagcat
ttgctgacatttgccgattgcgatgccatcggttactttaagaagcagggtttctccaag
gacatcaaactggcccgtcccgtctatgccggtttcattaaagagtacgatagcgccact
ttgatgcattgtgaattgcatcccagcatagtcaacacgcagtttatagcagtcattcgg
aaacagagtgaaatccttaaagaattgattgcccaacgacatagtgaggttcaaaaggta
cgcactggtttaacctgtttcaaggagggtctaccatccataccggttgaatcgataccc
ggtttgagggaaatcggctggaaaccacaaatgcgtccagctcgctcatcgcgtcctcta
gaagaatccacggatcccgagaaattggccacatcgtttgcatctgtattacaatcagtg
cgtcaacataccactgcctggccattcctacgtccggtgacggccgccgaagttcccgac
tattatgatcacatcaaatatccaatggatctaaagacaatgggtgaacgtctcaagaag
ggctactatcagacacgtcgactctttatggccgatatggcacgcatattctccaattgc
cggttctataattcacccgatactgaatattatcgatgtgccaattcgctagagcgttac
tttcagaccaaaatgcgggaattgggtctttgggataaatga

DBGET integrated database retrieval system