KEGG   Drosophila willistoni: Dwil_GK12755Help
Entry
Dwil_GK12755      CDS       T01067                                 

Definition
GK12755 gene product from transcript GK12755-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 608 aa AA seqDB search
MPKVSCKCRSKKEVQVHVIYVGGAIGMVRNAEGVLIANENELSKQLRHNPNYHDPNFKPS
CVDCQPNQSFLVLPSVQDHPHRVIYDIVEYAPLLDSSCIGVDEWRRIANDLGKSYSRYDG
FVILHGTDTLAYTASALAFMLENLSKPVVITGAQIPIFETRSDGRDNFVGSLLLAGNYNI
PEVVVFFGNRILRGCRTSKVSSDSFNAFDSTNQMSLGRTGINFEINNRQIFRPCNLEKFT
VHVTMEKNVALLRLYPGISQNVVRALLSDPIKGVVIQTFGSGNVPSNREDILDELREAVD
RGVIVVNITQCASGIVLPHNTGNALWEIGVVPGYDMTQEAAFTKLCYVLGKPDWDLVNKK
KVMLLSLRGELTTNKIAKINDIDLIEGVARTLHLSTSKEREQMCSTFYPALVSAAVMEGD
VNKLTDLKQYGADLCDTNCDGRTALHLACYLGKLNCVCYLIAAGCSVNAHDRFNRTPLHE
AIDTDNHEIIRALLNSGAILRDPPEVQAELLRALTERGRIQRLESFRLAGADLTLADRTG
RTALHYACQLGNHEVVDYLLPYYTNRSIKDELGLSPIEYAKAAHHEHIVTLLRNRERPDN
PDPCLYTK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagtgtcatgcaaatgccgatcgaagaaagaagttcaagtccatgttatatac
gtgggcggggcaattggaatggtgaggaatgccgaaggagtcctaattgccaatgaaaac
gagctgtccaagcaactgcgtcataatcccaattatcatgatccaaattttaagcctagc
tgtgtggattgtcaaccgaatcaatcgtttttggttctgccgtctgtacaagatcacccg
catcgtgttatttacgacattgtggaatacgcaccattgttggactccagttgcattggc
gtagatgaatggagaaggatagccaatgatctgggaaagtcgtatagccgctatgatgga
ttcgttatcctccatggaacagacactttggcctacactgcctccgccctagcttttatg
ctagagaacttgagcaagcctgttgtgattactggagcccagattcccatctttgagaca
cgctccgatggtcgtgacaattttgtaggctccttgctactagctggcaattacaatata
cccgaagttgtggtcttttttggtaatcgcatcctgcgcggctgtagaacatccaaggtt
agctccgattcctttaatgctttcgactcaaccaaccaaatgtctttgggtcggactggg
attaactttgagatcaacaatcggcaaatatttagaccgtgtaatttggaaaagtttaca
gttcatgtgactatggagaagaatgtggcattgctacgtttatatccaggaatcagtcag
aatgtggtgcgtgctcttctgagtgatcccatcaaaggggtggtcatccaaacctttgga
tccggaaatgtgccgtcaaatcgggaggatatccttgacgagttaagggaggctgtcgat
aggggtgtcattgtggttaatatcacacagtgtgccagcggtattgtattgccacacaat
acaggaaatgcgttatgggaaattggtgttgtgccgggctatgatatgactcaggaagcg
gcatttaccaaattgtgttatgtcttgggcaaacccgattgggacttggtcaataagaag
aaggttatgcttttaagcctacgcggcgagttgaccaccaacaagattgctaagataaac
gatattgatctgatcgaaggcgtggctcgtactttgcatctgtctacctcaaaggagcgt
gagcaaatgtgttccacgttctatccagcccttgtatccgctgctgtgatggagggtgat
gttaataaactcaccgatttaaagcaatatggagccgatctttgtgacaccaactgtgat
ggtcgcacagccttgcatcttgcatgttatctgggaaaactgaactgtgtctgttacctg
atcgcagctggatgttcggtcaatgcacatgaccgctttaatcgtactcccttgcatgaa
gccatagatactgataaccatgagattatacgggctcttcttaatagtggtgccattctt
cgagatcctcccgaggtccaggcggaattgttaagagcccttacagagaggggaaggatt
caacgcttggaatcatttcgcttagctggtgctgatctcactctggctgatcgcacggga
cgcacagctctgcattatgcttgccagttgggtaaccatgaggtggtcgattatcttttg
ccctactatacaaatcgctctatcaaagacgagctaggattatcgcccattgaatatgcc
aaggccgcccaccatgaacatattgttaccctattgcgaaatcgggagaggccggataat
ccggatccctgtttgtatactaaataa

DBGET integrated database retrieval system