KEGG   Drosophila willistoni: Dwil_GK12755Help
Entry
Dwil_GK12755      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dwil_GK12755
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dwil_GK12755
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dwil_GK12755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Ank_2 Ank Ank_3 Ank_5 Ank_4 HTH_18
Motif
Other DBs
NCBI-GeneID: 6651279
NCBI-ProteinID: XP_002074190
FlyBase: FBgn0214764
UniProt: B4NKK4
Position
Unknown
AA seq 608 aa AA seqDB search
MPKVSCKCRSKKEVQVHVIYVGGAIGMVRNAEGVLIANENELSKQLRHNPNYHDPNFKPS
CVDCQPNQSFLVLPSVQDHPHRVIYDIVEYAPLLDSSCIGVDEWRRIANDLGKSYSRYDG
FVILHGTDTLAYTASALAFMLENLSKPVVITGAQIPIFETRSDGRDNFVGSLLLAGNYNI
PEVVVFFGNRILRGCRTSKVSSDSFNAFDSTNQMSLGRTGINFEINNRQIFRPCNLEKFT
VHVTMEKNVALLRLYPGISQNVVRALLSDPIKGVVIQTFGSGNVPSNREDILDELREAVD
RGVIVVNITQCASGIVLPHNTGNALWEIGVVPGYDMTQEAAFTKLCYVLGKPDWDLVNKK
KVMLLSLRGELTTNKIAKINDIDLIEGVARTLHLSTSKEREQMCSTFYPALVSAAVMEGD
VNKLTDLKQYGADLCDTNCDGRTALHLACYLGKLNCVCYLIAAGCSVNAHDRFNRTPLHE
AIDTDNHEIIRALLNSGAILRDPPEVQAELLRALTERGRIQRLESFRLAGADLTLADRTG
RTALHYACQLGNHEVVDYLLPYYTNRSIKDELGLSPIEYAKAAHHEHIVTLLRNRERPDN
PDPCLYTK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagtgtcatgcaaatgccgatcgaagaaagaagttcaagtccatgttatatac
gtgggcggggcaattggaatggtgaggaatgccgaaggagtcctaattgccaatgaaaac
gagctgtccaagcaactgcgtcataatcccaattatcatgatccaaattttaagcctagc
tgtgtggattgtcaaccgaatcaatcgtttttggttctgccgtctgtacaagatcacccg
catcgtgttatttacgacattgtggaatacgcaccattgttggactccagttgcattggc
gtagatgaatggagaaggatagccaatgatctgggaaagtcgtatagccgctatgatgga
ttcgttatcctccatggaacagacactttggcctacactgcctccgccctagcttttatg
ctagagaacttgagcaagcctgttgtgattactggagcccagattcccatctttgagaca
cgctccgatggtcgtgacaattttgtaggctccttgctactagctggcaattacaatata
cccgaagttgtggtcttttttggtaatcgcatcctgcgcggctgtagaacatccaaggtt
agctccgattcctttaatgctttcgactcaaccaaccaaatgtctttgggtcggactggg
attaactttgagatcaacaatcggcaaatatttagaccgtgtaatttggaaaagtttaca
gttcatgtgactatggagaagaatgtggcattgctacgtttatatccaggaatcagtcag
aatgtggtgcgtgctcttctgagtgatcccatcaaaggggtggtcatccaaacctttgga
tccggaaatgtgccgtcaaatcgggaggatatccttgacgagttaagggaggctgtcgat
aggggtgtcattgtggttaatatcacacagtgtgccagcggtattgtattgccacacaat
acaggaaatgcgttatgggaaattggtgttgtgccgggctatgatatgactcaggaagcg
gcatttaccaaattgtgttatgtcttgggcaaacccgattgggacttggtcaataagaag
aaggttatgcttttaagcctacgcggcgagttgaccaccaacaagattgctaagataaac
gatattgatctgatcgaaggcgtggctcgtactttgcatctgtctacctcaaaggagcgt
gagcaaatgtgttccacgttctatccagcccttgtatccgctgctgtgatggagggtgat
gttaataaactcaccgatttaaagcaatatggagccgatctttgtgacaccaactgtgat
ggtcgcacagccttgcatcttgcatgttatctgggaaaactgaactgtgtctgttacctg
atcgcagctggatgttcggtcaatgcacatgaccgctttaatcgtactcccttgcatgaa
gccatagatactgataaccatgagattatacgggctcttcttaatagtggtgccattctt
cgagatcctcccgaggtccaggcggaattgttaagagcccttacagagaggggaaggatt
caacgcttggaatcatttcgcttagctggtgctgatctcactctggctgatcgcacggga
cgcacagctctgcattatgcttgccagttgggtaaccatgaggtggtcgattatcttttg
ccctactatacaaatcgctctatcaaagacgagctaggattatcgcccattgaatatgcc
aaggccgcccaccatgaacatattgttaccctattgcgaaatcgggagaggccggataat
ccggatccctgtttgtatactaaataa

DBGET integrated database retrieval system