KEGG   Drosophila willistoni: Dwil_GK12911Help
Entry
Dwil_GK12911      CDS       T01067                                 

Definition
GK12911 gene product from transcript GK12911-RA
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
dwi  Drosophila willistoni
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dwil_GK12911
Enzymes [BR:dwi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dwil_GK12911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1765 aa AA seqDB search
MSREVGESSNGFSRLSADARSITNGSVSLMHMQGAQTQGNRDSNNASNIAKAHRNFKLIA
DPQLVKCNGKLYRYDGIVPGDPTYPTITPRDPRNPLIRIRARAVEPLMLLLPRFLIDADY
VGQPPAIEVTVINLNDNIDKQFLTSMLDKCGTPDEIHIYHHPTTNKHLGIARIVFESTKG
ARQFVEKYNQKSVMGKILNVFCDPFGAILKQTIDNITNPVPVKPTPIPTTPIAQHPVPTM
MPGHEFSAEKDGMEHMMGPGGFNSFHKGADRNERDRDRNWERERERDRYVKDRDRDRSRH
SSERNYERDRGIRDKYTSSSASSSQRHDRHHYRRRSRDKSPEGIRDRDRDRFYASRDRDR
ERDGRQRDFPRSRERDGSFRERNRSRDRSRDRGPRDRRDHHRQSPSKERDYRERDRDRDR
DRSAETDRRDRLSVKYSKRYSSHEYSETSSEIGAGGSSHNSKNHQYYAGISATGYGYNNY
SYTMTENVQAWSSHRSWTAPQPDVQPQPPPPPPPPEDEEENWDDTVPPPPTRFDAKASSP
TTGVSPEKEPKTNSVSDTENVDLDTRIALIFKGRTFGNAPPFLQMDSSDSETDKDKEKDK
DKGKSDEAANPKAAVSEPQSDSNNSENHNKKQRQHRKEHGASDISSDDDGILVRKEAASS
KVEADQNCDDNMSLSSLSSHEDSANSTDQAIKKSVAASSSSASAAMTSYIYPTHPQPSDP
NQYYYPQHSAYGHYPPVIPGRYFSNPAYLPGVVSGAPFNLDLDPYAQTYGGYPESANALS
GQSDEMRQNVKKVINYIVEELKQILKRDVNKRMIEMTAFKNFEAWWDEQTVKARSKPLAE
STGEQANSQDKNTNAANANTNPSGNQEKAPDINHFINTPRDIPDFQTFSNIGIGIRAAMP
KLPSFRRVRKHPSPIPSQRRASLDRDLSDQEEMVQRSDSEDKDDSHLGDTTTTTSHTQNL
KERILDSERRDKHPKRRGSASSFFSSSSSSSSSDGDAGGAENDASSDDSFDDDGLQMRSV
NQRDRLMRKRRRDLKPVAEGDNMPSSIYSDSEDEKKPGHQDTDAPKRGRTKKIDIYSDTD
EDDSERQHHHKQTATVSTTKMVSSIPSDLEDISKDSSFGNYDDDAAEHIDEKFATGLKSG
DKTDEEFRRSPTPIPPPDYNEEEALPKHSNDADDDQVKTKQKSHFEYDRIYSDSEEEREY
QEKRRRNTEYMAQIEREFMEEQQRNKQNFASEVKKSELKLDITTKITSSSLPDTPDITKP
PPTPGGKILMEDMLLYNKSIDMTSITKESGVVKTEIDIVAVKVETETITPPVEHKTSLAN
GGTSSDLSSLPHDDDRNIEKGKQSPASSDGGSSQASQASQVALEHCYSLPPQAQSGAAAL
AVASKIKTPPDGSDLAGGKPGPGRPRKDSGRVTLKQKKKDSAPRQANAKTKMLSINDSLA
ELARQTANFVPYEMYNPRDQNEEMVILYTFLTKGIDSEDIKYIKMSYMDHLQKEPYAMFL
NNTHWVDHCTTDRAFWPPPPKKRRKDDELMRHKTGCARTEGYYKLDVREKAKHKYHHTKA
NADDVQNEDRCDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSMGESELLKFNQ
LKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSS
YLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGVNEEITY
DYKFPLEDEKIPCLCGAQGCRGTLN
NT seq 5298 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagaagttggcgaaagcagcaacggattctcacgtttatcggcagatgcaaga
tccataactaacggcagtgtctccttgatgcatatgcaaggggcccagacccagggcaat
cgcgacagcaacaatgcctccaatatcgccaaggctcatcggaattttaaactcattgcg
gatcctcagttggttaaatgtaatggtaaactatatcgctatgatgggattgttccgggt
gatcccacctatcccaccataacgccgcgggatccgcgtaatcctctgatacggattcga
gctagggcagtggagcccttgatgttgctcctgccgcgatttctcatcgatgcggactat
gtgggccaaccgcctgcaattgaagtgactgtgattaatctcaatgacaacatcgacaag
cagttcctcaccagcatgctggacaagtgtggaacgcccgatgaaatccacatctatcat
catccaaccaccaacaagcatttgggcattgcccgcattgtctttgagagcaccaagggg
gcgagacagtttgtcgagaagtacaatcaaaagtccgtgatgggaaagattttgaacgta
ttttgtgatccttttggtgcgattttaaagcaaaccatcgacaacataacgaatcccgtt
ccggtcaagccaacaccgataccgacgacgcccattgctcaacatccggtgccaacgatg
atgccaggtcatgaattcagtgcagagaaagatggcatggagcatatgatgggtcctggt
ggatttaactcatttcacaagggtgcagaccggaacgaacgtgatagggatagaaattgg
gaaagagagcgtgaacgcgatcgctatgtgaaagaccgggatcgagatcgaagtcgacat
tcctcggaacgaaattatgagcgtgatcgtggaatccgtgataaatatacatcgtcgtct
gcgtcgtcatcacaacgccacgaccgtcatcattatcgtcggcgttcaagagacaaaagt
ccagagggcatacgggaccgggatagggatcgattttatgcctcacgggacagggatcgc
gagcgtgatggtagacaacgagattttccccgctcccgggaaagagatggcagtttccgt
gagcgtaatagatcgcgcgaccgatcccgagatcgtggaccaagggacaggcgagatcat
catcgacagagtccgtcgaaggaacgagattaccgagaacgagatcgggatcgtgatcga
gatcgatctgcagaaacggatcgtagagatagattaagtgttaaatacagcaaacgctac
tccagtcatgaatatagtgaaacctcatccgaaattggagctggcggcagctctcataac
tcaaaaaatcatcaatattatgctggaatttcggccacaggctatggatataataattat
agctacaccatgactgaaaatgttcaggcctggtcctcacatcgaagttggactgccccc
caacccgatgtgcaaccacagccaccgccgccgccaccaccgcccgaagatgaagaggaa
aattgggatgatacagtaccaccgccaccgactagatttgatgcaaaggcaagttctccc
accacaggagtgtcgccggaaaaggagccaaagactaattccgtttcagatacggaaaat
gtagacttggatacacggattgctttaatatttaaaggcaggacatttggaaatgcgcct
ccattccttcaaatggatagtagcgactcggaaacggacaaggacaaggagaaagataaa
gataaaggcaaatctgatgaggccgccaatccaaaggcagctgtatctgagcctcaatcc
gattcaaataattccgaaaaccataacaagaagcaacggcaacatcgtaaagaacatggc
gccagtgatatatcgagtgatgatgatggtattttggttagaaaagaggcggcatcatca
aaagtcgaagcggatcaaaattgcgatgataatatgtctctgtctagtctctcttcccat
gaagattcggcaaattcaacagatcaggcaataaaaaagtcagttgctgcctcatcgtca
tccgcatccgcagcaatgacatcatacatttatcctacgcatcctcagccatctgatcca
aatcaatattattacccacaacattctgcatacgggcattatccccccgttataccaggc
cgatatttctcgaatccagcttacttgcccggtgtggtatcaggagcaccatttaacttg
gatttggatccttatgcccagacatatggcggctacccggagtcagcaaacgctttgtca
ggtcaaagtgatgagatgaggcagaatgtgaagaaagtcattaattacattgtcgaggag
ctaaagcagatcctcaagcgggatgtgaataagagaatgattgagatgacagcctttaag
aactttgaagcctggtgggatgagcagactgtgaaagcgcgctccaagcctttggccgaa
tcaacaggtgaacaggcaaattcgcaggataaaaatacaaatgcggccaatgccaacacg
aatccaagtggaaaccaagaaaaggcacccgatatcaatcattttattaatacgccaaga
gatattcccgatttccagacattctccaacattggaataggcataagggcggcaatgcct
aagctgccatcatttcggcgagttcgcaaacatcctagtcccattcccagccaacgaagg
gcgtccttggatcgcgatttgagtgaccaagaggagatggtgcagcgttcggattcggag
gataaggatgattcccatttgggtgacacaacgacgactacctcgcacactcagaatctt
aaggaacgcattttggattcggaacgcagggataaacatccaaagcggcgaggcagtgca
tcaagtttcttttcgtcctcctcctcgtcgtcgtctagtgatggagacgcaggcggggct
gaaaacgatgcgagcagtgatgatagttttgacgatgatggcctacagatgaggagtgtt
aatcaaagggacagacttatgagaaagcgtaggcgagacttgaaaccagtagccgagggc
gacaatatgccttcttcaatctattcggattcggaggatgagaagaaaccaggacatcag
gatactgatgctcccaagcgagggcgtacgaaaaaaattgatatttactctgatacggat
gaggatgacagcgagcgtcaacatcatcataagcaaaccgcaactgtttcaacaaccaaa
atggtatcatctataccatccgacttggaagatattagcaaagacagtagttttggcaat
tacgacgacgatgccgccgaacatatcgatgagaaattcgcaactggtctcaagtccggc
gataaaactgatgaagaatttcgcagatcacccacacccatcccgccgcccgactacaac
gaggaggaagcccttccgaagcatagcaatgacgctgacgatgatcaggttaagactaag
cagaaatcacattttgaatacgatcgcatttacagtgattcggaggaggagcgcgagtat
caggagaagagacgacgcaacaccgagtacatggcccagattgagcgagagtttatggaa
gaacagcagagaaacaaacagaactttgcctctgaagtaaagaaatctgaacttaaactg
gatattaccacaaagatcacgagcagcagtttgcctgacacgccggacataacaaaacca
ccgccaactccgggtggaaagatattaatggaagatatgttgctctacaacaagagcatt
gacatgacatctatcacaaaggagagtggagtagtcaaaacagaaattgatatagttgca
gtcaaggtggagacagagaccataactccaccagtggaacataagactagtctagccaat
ggcggcacctcctctgatctatcatcgctgccccatgatgatgatcgcaatattgagaag
ggcaaacaatctccagcctcttcggacggcggatccagtcaagcatcgcaggccagccaa
gtggccctggaacactgctattctctaccaccgcaagctcaatctggtgccgctgcactt
gccgtagcatctaaaataaaaacaccgccagacggtagtgatctagctggtggtaagccg
ggtcctggtcgaccacgcaaagattccggtcgtgttacattgaagcaaaagaaaaaagat
tcggcaccacgtcaggccaatgccaagacgaagatgctatcgattaacgattcattggcc
gaactggctcgccaaacggctaactttgtaccctacgagatgtacaatccgcgtgaccag
aacgaggaaatggtaattctgtatactttcctaacaaaaggcattgactctgaggacatc
aagtatatcaagatgagctacatggatcatttgcagaaagagccatatgctatgtttttg
aataacacccattgggtggatcattgcacaacggatcgagcattttggccaccgccaccg
aaaaaacgtaggaaagatgatgaattaatgcggcataaaacgggttgtgctcgcactgag
ggttactacaagttagacgtgcgggagaaggccaaacacaagtaccatcataccaaggcc
aatgccgacgatgtgcagaatgaagatcgatgcgacgagccgacagcgctaacgaatcat
catcacaataagctaatatcgaaaatgcaaggcatttcgcgggaggcgcgctcaaatcag
cgacgactgctcacagcttttggctcaatgggcgagtctgagctgcttaaatttaatcaa
ctcaaattccgaaagaaacaactgaaatttgccaaatcagctatccacgattggggatta
tttgctatggagcccatagcagccgatgagatggtcattgaatacgttggacaaatgata
cgaccagttgtggccgatttaagagagaccaagtatgaagcgattggaattggcagctct
tatctattccgcattgatatggaaacgattatcgatgccacgaaatgtggaaatctcgca
cgattcataaaccacagttgtaatcccaattgttatgccaaagtcattaccatagagtcg
gagaagaaaatcgtaatatattcaaagcagcccatcggtgtgaatgaggaaattacatat
gattacaagttcccattggaggacgaaaagatcccatgcctgtgtggcgcccaaggatgc
cggggtacgctcaactaa

DBGET integrated database retrieval system