KEGG   Drosophila willistoni: Dwil_GK13114Help
Entry
Dwil_GK13114      CDS       T01067                                 

Definition
GK13114 gene product from transcript GK13114-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dwi  Drosophila willistoni
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dwi04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dwi04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MGVYEQQSFSSKVDYKLILDKLREEFNKKFSQNTPSLAIGLDNYEIKATLGAGSFGKVQM
VKEKSSGNYYASKQLSKDQIMKTKQVAHVMSEKRVLRSIFFPFTVYLVASFKDNDSLYLI
LPIVPGGELFTYHRKVRKFSEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMIDKNGY
LKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVYEFVAGHSPFS
SHNRDMMSMYNKICECDYKMPSYFSGSLRHLVDHLLQVDLSKRYGNLINGNKDIKDHEWF
KEIDWIPLLNQTISPPYIPTISNPEDISHFDKISEGKPKTKAKTMRHEEIFADF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctatgagcaacagagtttcagttcgaaggtcgattataaattaatattagat
aagctgagagaggagtttaataagaagtttagccaaaataccccatccttggcgattggt
cttgataactatgagatcaaggccaccctgggagctggatcatttggaaaagtgcagatg
gttaaggagaagtcctcgggaaattattatgcctctaaacaacttagcaaggatcagata
atgaagacaaagcaagtggcccatgtgatgagtgaaaagcgtgtcctacgctcaatattt
tttccattcactgtctatttggtggcttctttcaaggataatgacagtctctatctaata
ttgcccattgtgccgggaggtgaactttttacctatcaccgcaaagttcgtaaatttagt
gagaaacaagcacgtttctatgcggctcaagtatttctggccttggagtatctgcatcat
tgcagtttactctatcgtgatttgaaaccagagaacattatgatcgacaagaatggttat
ttaaaggttaccgattttggttttgccaagaaagtggaaacacgtaccatgactttgtgt
ggtacaccagaatatttgccacccgagattattcaatcgaaaccatatggcactagcgtg
gactggtgggcttttggtgtattggtctatgaatttgtcgctggacactcgccattttcc
tcgcacaatcgggacatgatgagcatgtataataagatttgcgaatgtgattataagatg
ccttcctatttcagtggttcgttacgtcatctggtcgatcatttgttgcaggtggatctt
tctaaacgatatggcaatttgattaatggtaataaggatatcaaggatcatgagtggttt
aaggaaattgattggataccgctgctgaatcaaactattagtcctccctatataccaacc
attagcaatcccgaggatatttcacatttcgataagatctccgagggcaaacccaaaaca
aaggccaagaccatgcggcatgaggagatttttgctgatttttaa

DBGET integrated database retrieval system