KEGG   Drosophila willistoni: Dwil_GK13127Help
Entry
Dwil_GK13127      CDS       T01067                                 

Definition
GK13127 gene product from transcript GK13127-RA
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dwil_GK13127
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK13127
Peptidases [BR:dwi01002]
 Metallo Peptidases
  Family M67
   Dwil_GK13127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 422 aa AA seqDB search
MSKAVNNMNMGIVEPQERMKHLSHYGNLIEVDKNMPVTRYYRSGTEMLRMANVYLNEGNH
ENAFILYLRYMTLFIEKIRQHPDYASVKAEVKAINKKIKDEIMPTTEKLRAKLLAHYQRE
YEQFLASKEAERVRELERERQRLKELASRQAGGSGGIPSIIPANLHVQMDDKLQPTAPDL
SLLDHVVYPNDFPTGANRSANLPNSGLLLPAAADPPASDKSTSLHPKPAFDRNQKPQYNR
TDSLLAGSLRIVHVPGDTMDVFLQLARANTTNNIETCGVLAGHLAQNELYITHIITPQQQ
GTPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEALAI
VCAPKYNTTGFFILTPQYGLDYIAQCRQSGFHPHPNDPPLFMEAQHMKIDNQTKIKVIDL
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaggcggtgaataatatgaacatgggcattgtggagccacaggaaaggatgaaa
catctctcgcattacgggaatcttatcgaggtggacaaaaacatgccagtgacacgctac
taccgttctggcaccgagatgctgcgcatggccaatgtatacctcaacgagggtaaccat
gagaacgccttcatcctgtatttacggtacatgactctgttcattgagaagatacgccag
catccagattatgccagtgtcaaggcagaagtgaaggccataaacaaaaagattaaagat
gagattatgcccacaacggagaagttaagagcaaagttgctagctcactaccagagagaa
tacgagcaattcctggccagcaaggaggcggaaagagttcgagaattggagcgggaacgc
cagagactcaaagagctggccagtcggcaggcgggtggctctggcggcattccatccatt
attcccgccaatctccatgtccagatggatgataaattacagcccacagctccggatctt
tccttgctggaccatgtggtgtatccaaatgactttcccacgggagccaatcgcagcgcc
aacttgcccaactctggcctcctcttgccagcggcagcggatcctcctgcaagcgacaag
tccacaagcttgcatccgaagcccgccttcgataggaatcagaagccacaatacaatcga
actgattcactgctggcgggctcattgcgcattgtgcatgtacctggcgataccatggat
gtgttcctacaattggcacgagccaataccacaaataacatcgaaacttgtggcgttctg
gccggtcatctggcccagaatgagctctacatcacgcatatcatcacaccccagcagcag
ggtactccagatagctgtaataccatgcacgaggagcagatctttgatgtgcaggatcag
atgcaactcatcacgttgggctggattcatacgcatcccagtcagacggcttttctatca
tctgttgacctgcacacacattgttcctatcagatgatgatgcccgaagctctagccatc
gtgtgtgcacccaagtacaataccactggtttcttcatacttacaccacagtatggactg
gattatatagcccaatgtcggcaatcaggctttcatcctcatccaaatgatccgccattg
tttatggaggctcagcatatgaaaattgataaccagaccaaaatcaaagtgatcgatcta
cgcagatag

DBGET integrated database retrieval system