KEGG   Drosophila willistoni: Dwil_GK13137Help
Entry
Dwil_GK13137      CDS       T01067                                 

Definition
GK13137 gene product from transcript GK13137-RA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
dwi  Drosophila willistoni
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dwil_GK13137
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dwil_GK13137
Ubiquitin system [BR:dwi04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     Dwil_GK13137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 885 aa AA seqDB search
MMIQEPVQAAIWHCLNHYDLKDAIFLSERLCSEVESDETIFLLATSYFRSNLIHQAYWLL
KEKSRRSPQCRFLQAKCAFELKNYADAESILITTGYVDTKHFDDLQKEFGELACFVYQLL
AQICMQTERHKLAVQALRRTLKLNPFMWSAFTDLCLLGQDADVGSIFQIQSTDVFNTCQG
STANANAMVIFGSNGVNGGGSIGVGGGVGGGGASCDKEQLTNYLLNTPIDQQQPIQTPPN
HLNNNNINLNSSIGMLRGCTGSGGVGTGLLEDTPMSGYNQEYDVTPFRKQIKYLSTFSPS
FGIMPLTSPCAGGDNSYSSYHGSPLPQIFSEVNQDAKIMGKKLKTIGVVGGGVGGGIINR
KDVKPNVFTQAGNITPRTPISNNSINNNVSQANGNPITGNPNNAVRRSSRLFSNSTYSSV
KENNKSTNFTNNKFVQPRSPPRKTKNRIPKICLNNELKEKVETITTSSIASNNNNNNNNN
NNARNPTEEAKVLLNNSLNNAQTMAHQLLNLKKQSADGLMSLLRDLADGYKLLSNYRCKA
SIKHLETTIPKHHLSSSWVQSLIGQAFYEQRDYESAISIFRQIHEMDPYRLDYMEIYSTS
LWHLQREVELSALAQDLINQDKRNPITWCVSGNCFSLHKEHETAIKFLKRAVQIDPDFVY
SYTLLGHELVLTEEFDKAMDYFRSAVVRDPRHYNAWCGIGTIYSKQEKYELAELHYIKAL
KINPQNSVILVHIGAMQFFMQKKDLALQTLNTAATLDPKNPLARFHRGSIYFSLGKYQEA
LRELEELKEIVPKESVVFYLIGKIHKTLGNMDLALMHFSWATDLDPKGANNQIKDAFDSM
AHPSCCPATSSANDTNTLDVDFEPTSERSDDSTQAQQDVSYDSDY
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgatgatacaagaacctgtgcaggcggccatatggcattgtctgaaccattacgacctc
aaggatgccattttcctttccgaacgtctatgctctgaagttgaaagtgatgaaacgatc
tttctattggccaccagttattttcgatccaatctcattcatcaggcctattggttgctc
aaagagaagtcacgccgttcaccacaatgccgtttcctgcaggcgaaatgtgccttcgag
ctaaagaattacgctgatgcggaaagtattttaataaccactggctatgtggatacaaaa
cattttgatgatttgcaaaaggagtttggtgaactggcctgctttgtttatcagctgttg
gcgcaaatttgcatgcaaaccgaacgccataaattagcggttcaggcattgagacgaacg
ctaaagttgaatccattcatgtggagtgcatttaccgatctgtgcctgctgggacaggat
gcagatgttggttcaatatttcaaatacaaagcacagatgtgttcaatacgtgtcaagga
agcacagcgaatgccaatgctatggtcatctttggaagcaatggcgtcaatggtggtggt
agtattggtgttggaggaggagtaggaggaggaggagccagttgcgataaagagcagtta
accaactatttattgaatacgcccatagatcagcagcaaccaattcaaacgccgccaaat
catttaaataataataacattaatctcaatagctccattggcatgctaagaggttgtact
ggtagtggtggagtaggaactggccttttggaagataccccaatgtctgggtacaatcaa
gagtacgatgtcacaccctttcgcaagcaaatcaaatatctatccaccttttcacccagt
tttggtattatgcctctaaccagtccatgtgctggcggagacaactcctattcctcctat
catggctcacccctgccacagattttctccgaggttaatcaagatgcgaaaataatgggc
aaaaaactcaaaacaattggtgtggttggtggaggagtaggcggcggcataatcaatcgc
aaggatgtaaagccaaatgtattcacccaagctggcaatatcactccacgtacgcctatt
agcaacaatagcattaataataatgttagccaggccaatggtaatcccattaccggtaat
cccaataatgccgtcagacggagctctcgacttttcagcaattccacctattcatcggtt
aaggagaacaacaaatcaaccaatttcactaataataaatttgtccagcctcgatcaccg
ccgaggaaaaccaaaaatcgcatacccaaaatatgcttgaataatgaactaaaagagaaa
gtggagactataaccacttcctcgatagcatctaataataataacaacaataataacaac
aataatgcaagaaatccaacggaggaggcaaaagtgttgctcaacaacagcctcaataat
gcccaaacgatggctcatcaattgctgaatcttaaaaagcaatcggcagatggccttatg
tccctattaagagacttggctgatggctataaacttctctccaattatagatgtaaggca
tccattaagcatttggaaacaacaataccaaagcatcatttatcctccagttgggtgcaa
tcgttgattggtcaggcattctacgagcaaagggattatgagtcagctatctcaatattt
cgacaaatacacgagatggatccttatcgtttggattatatggaaatctattccacatcg
ctatggcatttacagcgagaagtagaactctctgccttggcacaggatttaatcaatcag
gataaacgtaatcccattacctggtgcgtttctggaaattgtttctccctgcacaaggag
catgaaacagccattaaatttttaaaacgcgctgtccaaattgatcccgatttcgtttat
agttacactctcctcggccatgaattggtccttacggaagaatttgataaagccatggat
tatttccgttcggctgttgtacgagatccaagacattataatgcctggtgtggcattggt
accatctattccaagcaggagaaatatgagctagccgaattgcattatataaaggcactg
aagattaatccacagaattctgttatcctcgtacacatcggggccatgcaattttttatg
caaaagaaggacttggcactgcaaactctcaatacagcagccacattagatccaaagaat
ccattggctagatttcatcggggctccatttatttctcattgggcaaatatcaagaagcc
ttgcgtgaactcgaagagcttaaagagattgtaccgaaggaatcggtggttttctatctt
attggcaaaatacataagactcttggtaatatggatttggccctaatgcatttcagttgg
gccaccgatttagatcccaagggtgccaataaccaaatcaaagatgccttcgattcaatg
gcacatcccagctgttgtccggccacttcatctgccaatgatacaaacactttggatgtt
gactttgagcccacttcagagcgttccgatgactcaacgcaggctcagcaggatgttagc
tatgatagtgactattaa

DBGET integrated database retrieval system