KEGG   Drosophila willistoni: Dwil_GK13141Help
Entry
Dwil_GK13141      CDS       T01067                                 

Definition
GK13141 gene product from transcript GK13141-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dwi  Drosophila willistoni
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dwil_GK13141
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dwil_GK13141
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dwil_GK13141
Lipid biosynthesis proteins [BR:dwi01004]
 Desaturase
  First
   Dwil_GK13141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 428 aa AA seqDB search
MCLSSPIPGQTTNGKGGTNTPEVSATNGGPCSLGEGCSSRTNGDLKHRGRHTKLDQATTE
ATEQHTKDEDNLGYKEENAVYKENNAKLETKQQEATVNEEEEEEFKPQIRWPDLIAQTFL
HSGALYGAYLLFYAKFYTFLWVVVTIWVSGIGITAGAHRLWSHKSYNASLALRILLAFAF
SISGQRDAYTWALDHRIHHKFSETDADPHNAKRGFFFAHVGWLFLTPHPKVAAKRDVIDM
SDLEADPVVMFQRKYNVPLFALCSIIIPVLVPWYFWQEDLWMSFWINFNMRFTWTLNVAF
FVNSVAHMYGKRPYDKNIMSREAPIVSLLAMGEGWHNYHHVFPWDYKTGEFGSYTLNVTT
GFIDLCARLGLASGRKVVSPDMIKRRAAKCGDGTRFLSDDYAHKDQVWGFGDRDLPREDL
AELAKMQN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctttcctcacccatccctggccagacgacaaatggcaagggaggtaccaatact
cctgaggtctcggccacaaacggtggcccatgcagcctgggagagggttgcagctccaga
actaatggagatctaaaacacagaggtcgccatacaaaactggatcaagccacaacagaa
gctacagagcaacataccaaagatgaggataatttaggttataaggaggagaatgctgtc
tataaggagaataacgcaaagctagagacaaagcaacaagaggcgacagtgaatgaggag
gaagaggaggaatttaagccacagatcagatggcctgatctaattgctcagacatttcta
cacagcggtgccctctatggagcctacctgctattctatgcaaagttctacacattccta
tgggtggtggtgaccatttgggtctcgggcattggcatcacggcgggagcccatcgtcta
tggtctcacaagtcgtacaatgcatcgttggctctacgcattctattggcctttgctttc
tctatatcgggacagcgcgatgcctacacgtgggcattagatcatagaatacatcacaaa
ttctcagagacagatgccgatccgcataatgcgaaacgtggattcttttttgcccatgtg
ggttggctattcctcacaccgcatccgaaggtggctgccaagcgtgatgtcattgatatg
tccgatctggaggccgatccggtggtcatgttccaacggaaatataatgtacccctcttt
gccctctgttcgataattattcctgttcttgtaccttggtatttctggcaagaggatctc
tggatgtcattttggattaattttaatatgcgatttacttggactttaaatgtagccttc
tttgtgaatagtgtggctcatatgtatggcaaaaggccgtacgataagaatattatgtca
agagaggctcccattgtctcccttctggccatgggcgaaggttggcataactatcatcat
gtattcccctgggactacaagactggagaatttggttcatataccctgaatgtgaccaca
ggtttcattgacttgtgcgcacgtttgggcttggccagtggacgtaaagttgtttctccc
gatatgattaagcgacgtgcagctaaatgcggcgatgggacacgtttccttagtgatgat
tatgcacacaaggatcaggtttggggctttggcgatagggatttgccacgtgaagatcta
gccgagctggccaaaatgcaaaattga

DBGET integrated database retrieval system