KEGG   Drosophila willistoni: Dwil_GK13151Help
Entry
Dwil_GK13151      CDS       T01067                                 

Definition
GK13151 gene product from transcript GK13151-RA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dwil_GK13151
   01230 Biosynthesis of amino acids
    Dwil_GK13151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dwil_GK13151
   00051 Fructose and mannose metabolism
    Dwil_GK13151
   00562 Inositol phosphate metabolism
    Dwil_GK13151
Enzymes [BR:dwi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dwil_GK13151
Exosome [BR:dwi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dwil_GK13151
  Exosomal proteins of bladder cancer cells
   Dwil_GK13151
  Exosomal proteins of melanoma cells
   Dwil_GK13151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 308 aa AA seqDB search
MNNNQNRSPGDVTLDVFTGVISQVFLGKFTAVFPKLFKCQWKTYEGQKKFYADFSTDNSN
MSGRKFCVGGNWKLNGDQKSITEICKTLSGASLDPNTEVVIGCPAIYLMFARNLLPCSIG
VAGQNAYKVAKGAFTGEISPAMLKDIGAEWVILGHSERRAIFKESDELIAEKAEHALAEG
LKVIACIGETLEEREAGKTNEVVARQMCAYAKKVRDWTNVVVAYEPVWAIGTGKTATPDQ
AQEVHAYLRQWLTENVSKEVAASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEF
IEIINARQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaccaaaatcgtagccccggcgacgtaacgctggacgtattcactggcgtt
atctcgcaagtttttctcggcaaattcacagctgtttttccaaagcttttcaagtgccaa
tggaagacatatgaaggtcagaagaagttttacgcagacttcagtacagacaacagcaac
atgagcggacgcaaattctgtgtgggtggcaactggaagttgaacggtgaccaaaagtca
atcaccgaaatctgcaaaactctaagcggagcctccctggatcccaacaccgaggtggtc
attggctgccctgccatctatctgatgttcgcccgcaacttgctgccatgcagcattggt
gttgccggccagaatgcctacaaggtggccaagggagccttcaccggtgaaatctctccc
gccatgttgaaggacattggcgccgagtgggtcatcctgggtcactccgagcgtcgtgcc
atcttcaaggaatccgatgaattgattgccgagaaggccgagcatgccctggccgaggga
cttaaggtgattgcctgcattggtgagaccctggaggagcgtgaggctggcaaaaccaac
gaggttgtcgcccgccagatgtgcgcctatgccaagaaggtgcgtgactggaccaacgtt
gtggtggcctacgagccagtgtgggccattggtaccggcaagactgccacccccgatcag
gcccaagaagtgcacgcctatctgcgccaatggttgactgagaatgtctccaaggaagtg
gccgcttcgcttcgcattcaatacggtggctctgtgactgctgccaatgccaaggagctg
gccaagaagcccgatattgatggtttccttgtcggtggtgcttcattgaagccagaattc
attgagattatcaatgccaggcagtaa

DBGET integrated database retrieval system