KEGG   Drosophila willistoni: Dwil_GK13151Help
Entry
Dwil_GK13151      CDS       T01067                                 

Definition
GK13151 gene product from transcript GK13151-RA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dwi  Drosophila willistoni
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:dwi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dwi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dwi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dwi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dwi00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 308 aa AA seqDB search
MNNNQNRSPGDVTLDVFTGVISQVFLGKFTAVFPKLFKCQWKTYEGQKKFYADFSTDNSN
MSGRKFCVGGNWKLNGDQKSITEICKTLSGASLDPNTEVVIGCPAIYLMFARNLLPCSIG
VAGQNAYKVAKGAFTGEISPAMLKDIGAEWVILGHSERRAIFKESDELIAEKAEHALAEG
LKVIACIGETLEEREAGKTNEVVARQMCAYAKKVRDWTNVVVAYEPVWAIGTGKTATPDQ
AQEVHAYLRQWLTENVSKEVAASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEF
IEIINARQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaccaaaatcgtagccccggcgacgtaacgctggacgtattcactggcgtt
atctcgcaagtttttctcggcaaattcacagctgtttttccaaagcttttcaagtgccaa
tggaagacatatgaaggtcagaagaagttttacgcagacttcagtacagacaacagcaac
atgagcggacgcaaattctgtgtgggtggcaactggaagttgaacggtgaccaaaagtca
atcaccgaaatctgcaaaactctaagcggagcctccctggatcccaacaccgaggtggtc
attggctgccctgccatctatctgatgttcgcccgcaacttgctgccatgcagcattggt
gttgccggccagaatgcctacaaggtggccaagggagccttcaccggtgaaatctctccc
gccatgttgaaggacattggcgccgagtgggtcatcctgggtcactccgagcgtcgtgcc
atcttcaaggaatccgatgaattgattgccgagaaggccgagcatgccctggccgaggga
cttaaggtgattgcctgcattggtgagaccctggaggagcgtgaggctggcaaaaccaac
gaggttgtcgcccgccagatgtgcgcctatgccaagaaggtgcgtgactggaccaacgtt
gtggtggcctacgagccagtgtgggccattggtaccggcaagactgccacccccgatcag
gcccaagaagtgcacgcctatctgcgccaatggttgactgagaatgtctccaaggaagtg
gccgcttcgcttcgcattcaatacggtggctctgtgactgctgccaatgccaaggagctg
gccaagaagcccgatattgatggtttccttgtcggtggtgcttcattgaagccagaattc
attgagattatcaatgccaggcagtaa

DBGET integrated database retrieval system