KEGG   Drosophila willistoni: Dwil_GK13174Help
Entry
Dwil_GK13174      CDS       T01067                                 

Definition
GK13174 gene product from transcript GK13174-RA
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dwil_GK13174
Peptidases [BR:dwi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dwil_GK13174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2766 aa AA seqDB search
MTFDTRRQNTGQPLTTTNNSSSNSTNTTTASPAHGTGNGTSNTGGNGSGGGSGGGGGGGG
AIETQSGEQTPATPAGDSLEGPATTSSSLDSTVTTVSPEKLISSFPTTKLRSLTQKISNP
RWVVPVLPEQELEVLLNAAIELTQAGVDHDCEPCVEFYRNGLSTSFAKILTDEAVNSWKY
NIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIVFDPDNKFNTFNAARQPECFAAPDCI
WGVLDSNKMFARPPPEPKNARGWLVDLINRFGQLGGFDNLLERFNSGLEILKRNQNQKKG
SGKSAASDSSSGDGTAQDNRLTLALIHSLLRPFGQCHELLTPATIAKYFMPTWNVVLDLL
DSFTDEELKREVKPEGRNDYINGIVKSARSLASRLTGQEELIRDLEMFRLKMILRLLQVS
SFNGKMNALNEINKVLSSVAYYSHRSQPLPHCMPDEMEMDWLTAERMAQWIKSSDVLGIV
LKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWD
FTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQE
VPPEVLDQAIGAHVKILDYSCSQERDAQKTIWLDKCVGELKAGDSWVLPALRLIRDICCL
YDTSPSHAPRTQTSTNRQQVIERLQNDYSLVILVTNSLTAYMDKIRHMVSETPSLDPASI
LIDGRFPHHVQIAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVNAVFPSDREECFRWFG
KLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHRGYM
LDNEDLIGKDYLWRVITTGGEEIANKAIDLLKEVSTALGPRLQENIAEFHEMFIGECCSR
LRTHYGNILILGKAPLGEDDANNQADDANDSKDSKMCFIEAEKMCRIIKVLQEYIKECDR
SFSGDRIHLPLSRVTRGKNTSLYIRFQNPGRPIDDIEIVTHSNETMAAFKRNLLKRIKGT
STANIKVDLFYTNGELIEVSDEINPLYQYTIRDKMILTAKLTPVGTGLASSPDSSSDSST
GSPPRPCPDMQRVESESTLPGVIISQNFQYTEFFLKLYQLGSDLDHGRLRDSAKVLLHLL
PCDRQTMRMLQLMCRVPKPQLAEKITKIEDDVINSMTSGEQQPTSNETEAESCTPEEMFL
HPSPGQVLYNLSVLHGLLIPALEPLGDAALQIQSSWMHSGCAHFVLELLTKNNFLPSADM
HTKRASFQCVLRLAKLFLYIVGSVLSRVGDEPLICDVDNGARSQVDILKQNFSSIPNGSQ
GTLRAISSKLAVILATEMLSASPEGDRCRSLFSSTLQWSCPDISTIKAVVQLAWASSCGN
LQALGSSNSDFEDEVIVPDGQDFSMCKEALEVLTISFILNPSANESLSNDPNWPKFITSI
VLKNPLRHVRQVASEQLFLASTYCAGDRKPFTYMVNLLVSSLKTLVPQFEATCAEFFSVL
CRTLSYGCIYNWPLQIGEGLLGDEIKWLKHIQANVKATGDTQVHEELLEGHLCLAKELMF
FLVPDSKAQLNELIHELIDDFLFTASREFLHLRRHGVLRQDTVPPPVCRSPHTIAAACDL
LIALCQLCVPNMKLLTNTLIDFVCTDTDPLREWDYLPPVGARPIKGFCGLKNAGATCYMN
SVLQQLYMVPAVRVGILKAHGAATNEGEDFSGDSDLTGGGLGSGFFSGAFSSSGTGEVDG
SDVRKSYHVVILKHVQAIFAHLGHSALQFYVPRGLWTHFKLQGEPVNLREQQDAVEFFMS
LFESLDEGLKALGHTQLMNATLGGSFSDQKISQECPHRYSKEEPFSVFSVDIRNHSSLTE
SLEQYVKGELLEGADAYHCDKCDKKVVTVKRLCVKKLPPVLAIQLKRFEYDYERVCAIKF
NDYFEFPRILDMEPYTVSGLAKLEGDVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHY
FSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAQCFGGDYMGEIYDNNLKRMQYRR
QKRWWNAYMLFYTRCDQSPVQFEPSVEQLSLTESRNMVLPLPKPIERSVRHQNIRFLHSR
SIFSVEFFNFIKKLGSCSIPSTRSDKITPAAEELSLLGVQLTSQFLFHTGFRTKKSLRGP
VIEWYDTLSHHIRSSALVRKWFANHALLSPPSRLGEYILMAPSPEVRTVFVKLVVFFCHF
AINDESLPGHEGSNLCEQVLISVLRLLRSDAADYGKHLPHYFSLFSMYVGLGLREKQQLL
KLNVPVQFIQVALDDGPGPSIKYQYPEFSKLHQVVSHLVRCSDISEKCQSSNQNARPLPN
PFKDPTVTQDDLTPLSSDCMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRA
VLTELLWQCGFAYCHDMRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRA
KTHYQKRAYQIIKCLTQLFHKSPIALQMLNTSPTISRQWTIAVEWLQDELERQRGIGCQY
NSYSWSPPAQSNDNTNGYMLERSQSAKNTWTMAFELCPEEVTEKPEQEENNESDLESNLD
DNKQETSQPATRQHEGTVSSDEMQPTKWPAPRTADSTAIPRLSRQLFGTHVSAGSGGTAP
STGAPVTATVTSGSGANSETESSAQETTADSNINGITNSMEHVENSVKKKYRRKVRRKVE
ENKDDDTEEVIEETTTTTTTTATTTTTTAATTEATKTTPTIAITAPNSATTTAVNELTSR
MEKNLI
NT seq 8301 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgatacgagacgacaaaacacgggacaaccactgaccaccacaaataatagc
agcagcaacagcacaaacacaaccacggccagtccagctcatggaacgggtaacggaact
agcaacacaggaggcaacggcagtggaggaggcagcggaggtggtggcggcggcggcgga
gcaattgagactcagagcggagagcaaacgccggctactccagcaggagattccttggaa
ggaccggccacaacgtcgtcatcattggatagcacggtgaccacagtgtctccggagaaa
ttgatatcttcatttcccaccactaaactacgctcgctaacacaaaagatatccaatcct
cgatgggtggtaccagttttgccagaacaggagttggaagtgcttctaaatgcggccatc
gagttaactcaggctggtgtggatcatgactgtgagccctgtgtggagttctatcgcaat
ggcctaagcacttcgtttgccaaaatcctaaccgacgaggcagtaaactcatggaaatac
aatattcatcactgtatcctggtgtcttgtggcaagcttttacacttgatagccatccac
atgcagcgggataatccgtatctgcttgatctgttagccattgtgttcgatccggacaat
aaattcaacactttcaatgctgcccgacagccggaatgctttgctgcccccgattgcatc
tggggtgtgctggacagtaataagatgtttgcgcggccgccgccagaaccaaaaaatgct
cgaggctggcttgtggatctcatcaatcgtttcggtcagttgggtggctttgacaatctt
ctagagcgatttaatagtggactggaaattttgaagcgcaatcaaaaccaaaaaaagggt
tcaggaaaaagtgcagcctcggatagctccagcggagatggcactgctcaggataatcgt
ttgacattggctcttatacatagcctgctgcgaccctttggccagtgccatgagcttctt
acaccagccacaatagccaagtactttatgcccacttggaatgtggtccttgatctactg
gatagttttacagacgaagaactaaaacgggaggtgaagcctgagggacgcaacgactat
atcaatggcattgtgaaatcagcccgctctctagccagccgtctaacgggtcaggaggaa
ctgatacgagatttggagatgtttcgtctgaagatgattttacgtctgctgcaagtctcc
agctttaatggaaagatgaatgccttgaacgagatcaataaagttctctcctcggttgct
tattactcgcatcgctcccaaccgttgccccactgcatgccggatgaaatggaaatggac
tggttgacagctgagcgtatggcccaatggattaagtcatcggatgtacttggtattgtt
ctcaaagattcgctgcatcagcctcaatatgtggaaaagttggagaaaattatacgcttt
ctgataaaagaacaggctctaacattagacgacctggacgcagtgtggcgggcccaggcg
ggcaaacacgaggcgattgtaaaaaacgtacacgacctgttggccaaattagcctgggat
tttactcctgagcagttagatcatctgtttgaggcgtttcaggctagcatgacaacagcc
aataaacgtcagagggaacgacttttagagcttattcgccgtctggccgaggacgataaa
aacggtgtaatggcccagaaagtgctcaaactattttggactttagcccacagtcaggaa
gtgccgccagaagtactggatcaggcaatcggtgcacacgttaaaatccttgactacagt
tgttcccaggagcgtgatgcacagaagacgatatggttggacaaatgcgtgggcgaacta
aaggcaggtgattcatgggttctgcctgcgctgcgactcatccgggatatatgttgccta
tatgatacatcgcctagtcatgcgccacgtacccagactagcaccaatcgtcagcaggtt
atcgagcggttacagaatgactattccttggtcatactggtcacaaatagcttaaccgcc
tatatggataaaatccgtcatatggtcagcgaaacaccaagtctggatccagctagcatt
ttgattgatggacggtttccgcatcatgtgcaaattgctgaacgcttggaatttctcaaa
tttctgctcaaggatggccagctctggctatgtgccgatcaggctaagcaaatctggcat
tgtctagcggtaaatgctgttttcccgtcggatcgcgaggaatgtttccgctggttcggt
aaactaatgggcgaggaaccggatttggatccaggcatcaataaggatttctttgagaac
aacattctgcagctggatccacatttgctgactgaaagcggtataaagtgtttcgagcgc
ttttttaaagcggtcaattctaaggaggacaaactgaaggccattcatcgtggctatatg
ctggataacgaagatctaatcggcaaggactatctgtggcgtgtgataaccacgggaggc
gaagagattgccaataaggccatagatctgctcaaagaggtttccacggccttggggcca
cgtttgcaggagaatattgctgaatttcatgaaatgtttattggagaatgctgttcgaga
ctgcgaacccattatggcaacatactgattttgggtaaagccccgttgggagaggacgat
gccaacaatcaggcggatgatgccaatgactcaaaggactctaaaatgtgcttcatcgag
gccgagaagatgtgccgtattattaaggtgctgcaggagtacattaaggaatgcgatcgc
tcctttagcggggatcgtatccacctaccactgagtcgtgtaactcgcggcaaaaacact
agtctttacatccggttccagaatcccggacggcccatcgacgacattgagattgtgacg
cacagcaatgagaccatggcggccttcaagcggaatctgcttaaacgaatcaagggtaca
tcgacggccaacatcaaagtggatctgttttacacaaacggcgagctgatagaggtttcc
gacgaaatcaatcccctttatcagtatactatacgagataaaatgatcctaacggctaag
ttgaccccagttggaactggcctggctagcagtcccgattcctccagcgattcaagcact
ggatcacctccgcgaccatgccctgatatgcagcgcgtggagtcggagagtactctgcct
ggcgtgattatttcacagaactttcaatacaccgagttcttcctaaagctttatcagctt
ggcagtgatctggaccatggacggctgcgtgacagtgccaaggttctgctccatctcctg
ccctgtgaccgccagacaatgcgaatgcttcagctgatgtgtcgagtgcccaaaccacaa
ttagccgaaaaaatcaccaagattgaagatgatgtgattaactcgatgactagcggtgag
caacaaccgacgagcaacgaaactgaagcggaaagttgtacgccagaagagatgttcctg
catccttcgcccggccaggtgttgtacaatcttagcgttttgcatggtcttctgataccc
gctttagaaccgctgggagatgccgctcttcaaatacaatcgtcttggatgcattccggt
tgcgctcattttgtgctcgagctgttaaccaagaacaactttttgcccagtgccgatatg
cacacgaaacgcgcctcttttcaatgtgttctgcgattggccaagctcttcctatatatc
gttggcagcgttttgtcacgagtgggtgacgagccattgatctgtgatgtcgataacgga
gcccgctcccaggtggatatactgaagcaaaatttctcatctataccgaatggatcacag
ggcacattgagagccatttcatctaagttggcagttatattggctacagaaatgctatcg
gcaagcccggagggcgatcgatgtcgctcactatttagttccactctgcaatggtcgtgt
ccagacatatctaccattaaggcggtggttcaactggcttgggcctcttcctgtggcaat
ctgcaggctttgggtagcagtaacagtgatttcgaagacgaggtgattgttccagatggt
caggactttagtatgtgcaaagaggcacttgaagtgcttaccatttcttttatactcaat
cccagcgcaaatgagtctctcagtaacgatcccaactggcccaaattcatcacatcaatt
gtattaaaaaatcctttgagacatgtacgccaagtagcttcggagcaactatttttggct
tccacatactgtgccggcgataggaaaccctttacctatatggtcaatttgctggtgagc
tctctgaagactttggtacctcaattcgaagccacctgtgccgagtttttctccgtattg
tgtcgcactctttcctatggctgtatctacaactggccactgcagattggcgagggtctt
ctcggagatgaaattaaatggttgaaacacattcaagcgaacgttaaagccaccggagac
acccaggtccatgaggagctacttgaaggtcatctctgtctggcaaaagaactgatgttt
ttccttgtgcccgactcgaaggctcaattaaatgagttaattcatgagcttatcgatgat
ttcctttttacggcctcgagagaatttctgcatttacgtaggcatggtgtccttcggcag
gatacagtgccacctccggtttgccgcagtcctcacactattgccgctgcctgcgatctc
ctaatagctctgtgccagctctgtgttcctaatatgaaactactcactaatacactaatc
gatttcgtttgcacagatacagatccgctgcgcgaatgggattacctgcctccggtgggt
gctagaccaattaaaggtttctgtggactgaaaaatgccggagccacctgttatatgaac
tcggtgctgcaacagctttacatggtgccggccgtccgtgtaggtattcttaaagcccac
ggagcggccactaatgaaggtgaagactttagtggcgattcggatttgactggtggagga
cttggatctggatttttctctggtgccttctcttcatccggaacgggggaagtggatggt
tcggatgtgcgtaaaagctatcatgtggttattcttaaacacgtccaggctatattcgct
cacttgggtcacagtgcattacagttctatgtaccacgtggcctctggacgcatttcaag
ctgcaaggcgagccagtaaatctacgcgagcaacaggatgccgtcgagttctttatgtca
ctttttgaaagcctcgacgagggacttaaggctttgggtcacacccaattgatgaatgca
acgttgggtggatcgtttagcgatcagaagatcagtcaagagtgcccacatcgctactcc
aaagaggaaccatttagcgtatttagtgttgatattaggaatcatagctcattaaccgaa
tctctggagcagtatgtcaagggagagctgctcgagggggccgatgcataccattgtgat
aaatgtgataaaaaagtagttaccgttaagcggctctgcgtgaagaagctgcctcccgtg
ttagccatacaactgaagcgctttgaatacgactacgagcgcgtctgtgcgattaagttc
aatgattattttgaatttccacgtatcctggatatggaaccctatacagtttctggccta
gctaaactggagggcgatgtggtggaagtaggtgataattgtcaaacaaatgttgaaaca
acaaaatatgaactgaccggcattgtagtccacagcgggcaggcctccggtggacactac
ttcagctacatactttccaaaaatccagccaatggtaaatgccaatggtacaagtttgac
gatggcgaagtaaccgaatgcaaaatgcacgaagacgaagaaatgaaggctcagtgcttc
ggtggcgattatatgggagagatctatgataacaatttgaaacgcatgcagtatcgccgg
caaaaacgatggtggaatgcctatatgctgttttatacgcgttgcgatcaaagtcctgtc
cagtttgagcccagtgtggagcaattgtcgctaacagaaagccgaaatatggttttacct
ttaccaaagcccatcgaacggagtgtacggcaccagaatatacgattcctacactcgcgc
agcatattctctgtggaattctttaatttcattaaaaaactaggtagctgcagcataccc
tctactcgaagcgataaaattacacccgcagctgaagagctttccttgttgggtgtccaa
ttgacatctcagtttttgttccatactggcttccgcacgaaaaaatcattgcgtggtcct
gttattgaatggtatgatacgctttcacatcacattcgttcctcggcattagtgcgtaaa
tggtttgccaatcatgctttactttcgccgccatcgcggcttggcgagtatatactcatg
gctccgtcacccgaggtccgtaccgtatttgtgaagttggttgtgttcttttgtcacttt
gccattaacgacgaatcgctacccggccacgagggcagtaatctctgtgaacaggtgcta
atcagtgtactgcgtctattaaggtcagatgcggcagattatggcaaacatttgccacat
tactttagcttatttagtatgtatgtcggcctgggccttcgtgagaaacaacaattacta
aagctcaatgtgccagtgcaattcattcaagtggctttggatgatggacctggtccatct
attaaataccagtatcccgagttcagtaaactacatcaagttgtctcacacttggttcga
tgcagcgatataagcgagaagtgtcagagctccaatcagaatgctcgaccactgcccaat
ccctttaaggaccccactgtaacgcaggatgatctaacccccttgtcaagcgactgcatg
gatctgctttttaatcgtaccggttatatcaagaaagtgatagaggacaccaatgtgggt
gatgagggtctcaaattactgcaatactgcagctgggagaatccgcatttctctcgtgcc
gtactgaccgagctgctgtggcagtgtggtttcgcctactgccatgacatgcgtcatcat
acagatctgttgctgaatatcttactgatcgatgattcgtggcaacatcatcgcatccac
aatgcccttaacggagtggccgaggaacgcgagggtttgctggagacgatacaaagagct
aaaacccactatcagaagcgggcctatcagattatcaaatgtctgacgcaactgttccac
aaatcaccaatagccctgcagatgttaaatactagtccaactataagtcggcaatggacc
attgccgtggagtggcttcaggatgagctggagcgacagcgcggcattggctgtcagtac
aattcgtattcgtggtcaccacctgcacagagtaatgacaacaccaatggctatatgcta
gagagatcgcaatcagctaagaacacctggaccatggcatttgagctctgtccggaggag
gtgaccgagaaaccggaacaagaggagaacaatgagtccgatttggagtctaatttggat
gataacaaacaggagacgtcacaaccagctacccgtcaacatgagggaactgtaagcagt
gacgaaatgcagccaaccaaatggccggctcctcgtacggcagatagtaccgccattccg
cgcctatcacgtcaactatttggcacgcacgtgtcagctggttccggtggaacagcccct
agtactggggcccccgttaccgccacagtaacaagtgggagtggagccaatagcgaaaca
gagagcagtgcccaggagactacagccgattcaaatataaatggcatcacaaatagtatg
gaacacgttgaaaattcagtaaaaaagaaatatcgcaggaaagtgcgaagaaaggtagag
gaaaataaggatgatgacactgaggaagtaatagaagagacgacgacaacaacaacaaca
acagcaacaacaacaacaacaacagcagcaactacagaggcaacaaaaacaacgccaaca
atagcaataacagcgccaaatagtgcaacgacaacggccgtcaatgaacttacttcaaga
atggagaaaaaccttatttaa

DBGET integrated database retrieval system