KEGG   Drosophila willistoni: Dwil_GK13189Help
Entry
Dwil_GK13189      CDS       T01067                                 

Definition
GK13189 gene product from transcript GK13189-RA
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dwi  Drosophila willistoni
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dwi00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dwi00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dwi04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 560 aa AA seqDB search
MFTSKYFWLIAGILLIAAIGNGQAETFPCKIKEAEYGKVCVCTSDYCDYLDNPILTSDTE
FTLISSSKQGLRFATSSGNFGTESKHIVDDYEEPAAETNNDEFLTELWENTLASAFTVES
RESAITRYVALKLNRSTTYQTITGFGGSFTGAVSHILENFNNQDIDNHLYKSFYGEEGLG
FNLMRTPIGGCDFDLSPWSYSEEDGDTELSGMDQLDERDVIRVAQMKRLIEVSGAKNLKI
KGAAWSAPPWMKTNNKWTGFGRLKRAYYQTWADYHLKWVKLMEDNGLPIWAISTGNEPLN
GIFFMFFVKFMSMGWTPQTQAIWVNDYLGPTIRNSAFKDLVIFSNDDQRYSFPHWFKMMN
YTRPNSLDYLDGLSVHWYWDEIFGNSFIDSTNNYIADKLLIVSESCIGDKPWQKAAPLLG
SWERAEKYARDYLQNLKLGFHGWIDWNIILDEQGGPNYVDNTVDAPVIANTTTYEEFYKQ
PMFYAMGHFSKLVPEGSVRIEASPSNVNLDSVAFERPDKKIAAILFNSGRADVDITVDDS
VRGSFIVNVPAKSIHTLLYS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgttcactagcaaatatttttggctaattgctggaattttgctgattgcagcaattggc
aatggacaagcggaaacatttccctgtaaaataaaagaggccgaatatggcaaggtgtgt
gtgtgtacgtcggactattgcgactatttggacaatcccatcttaacgagtgacacagaa
ttcaccctcatatctagttcgaagcaaggacttcgctttgccacttccagcggaaatttt
ggaacagagtcaaagcatattgtcgatgattatgaagaacctgctgctgaaacaaataat
gatgaatttttgacagagctatgggagaatactctggccagcgccttcacagtggagtca
agagaaagtgcaattactcgatatgtggctctgaaattaaatcggagcacaacatatcag
acgattaccggatttggtggcagttttactggagcagtttcccatatattggagaacttt
aacaatcaggatatagacaatcatctctacaagtccttctatggcgaagagggattggga
ttcaatttgatgcgtactccaattggaggatgtgattttgatttgagtccttggtcctat
tcagaggaggatggcgacactgaattaagtggcatggatcagctagatgaacgagatgta
attcgggtggctcagatgaaacgtttaattgaggtgtcgggagccaagaacctgaagatc
aaaggagccgcctggagtgctccgccatggatgaagacgaacaacaaatggactggattc
ggacgcctaaagcgggcatattatcaaacttgggccgactatcatctcaaatgggtgaag
ctgatggaggataatggtctgcccatttgggccatatccacgggtaatgaacccctaaat
ggaatattttttatgttctttgtcaaatttatgagcatgggatggacgccacagacccag
gctatatgggtcaacgattatctaggacctaccattcgcaattctgccttcaaggatctt
gtaatattcagcaacgatgatcaacgttattcattccctcattggttcaaaatgatgaac
tacacacgcccaaattcacttgattatctcgatggattatcagtgcattggtattgggat
gaaatatttggcaacagttttatcgattccactaacaattatattgctgataagttgcta
atcgtatctgaatcatgcataggcgataagccatggcaaaaagcagcccccctactaggc
agttgggaacgtgccgaaaaatatgcccgagattatttgcaaaatctgaagcttggattc
catggctggattgactggaatattattctggatgagcagggtggaccgaattatgtggac
aatacggttgatgctcctgtcatagccaatacaacgacttacgaagagttttataagcaa
cccatgttctacgccatgggacacttttctaaacttgtgccagagggatctgttcggatt
gaggcatccccaagtaatgtcaatttggattcagtggcatttgagcgacctgataagaaa
attgctgccatccttttcaatagtggacgagccgatgtggatatcactgtggatgatagt
gtgcgaggcagctttattgtcaatgtgccagccaagtcgattcacactttgttatatagc
taa

DBGET integrated database retrieval system