KEGG   Drosophila willistoni: Dwil_GK13277Help
Entry
Dwil_GK13277      CDS       T01067                                 

Definition
(RefSeq) GK13277 gene product from transcript GK13277-RA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dwi  Drosophila willistoni
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dwil_GK13277
   00053 Ascorbate and aldarate metabolism
    Dwil_GK13277
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dwil_GK13277
   00860 Porphyrin and chlorophyll metabolism
    Dwil_GK13277
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dwil_GK13277
   00982 Drug metabolism - cytochrome P450
    Dwil_GK13277
   00983 Drug metabolism - other enzymes
    Dwil_GK13277
Enzymes [BR:dwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dwil_GK13277
Glycosyltransferases [BR:dwi01003]
 Others
  Hydrophobic molecule
   Dwil_GK13277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 516 aa AA seqDB search
MLVLRFFGFLLLIKYLDGARILAIFPYPGPSQYINVVSYLKALASRGHQVDSVNAFPQKQ
QVNNFQDIPVLEVFKGYEDLITDLGDPMNIWEENNFENGFFLNITTKVLENKEVQKRLLS
KGKAQYDLIILEALRADVLYAFGAHFNAPIIGISTFGTDWDIDKLVGNTSPLSYIPLITA
GLSDRMTFSERISNFVKTSVAWLNYNWVHMPKHEELYKKYFPHIADKFQLSELAKNISLV
LLNQHFSLSFPRPYVPNMIEVGGLHIAHKPAALPKEMEDFIQGAGKAGVIYFSLGSNVKS
KDLPEEKRRMLLETFASLPQRVLWKFELDHLPEKPANVFISKWFPQPDILAHPQVKLFIT
HGGLLSTIESIHHGKPVLGLPFFYDQFLNIARAKRAGFGLGLSHADMTGSEFKTTIERLL
NEPSFMATAQAMSARYRDQPMSPQDTAIWWTEYILRHKGASHMRVAAQDLNFFAYHSLDV
LATLIGGAFVAIGLVLFALTKVLRFTQGTKTKQKTM
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtccttcgattttttggttttttactgttaataaagtacttggatggtgctcgg
atattggccatatttccatatcctggcccatcgcaatatatcaatgtagtgtcatatctt
aaagcgcttgcctcccgtggccatcaagtcgactcggtgaatgcctttcctcaaaagcag
caagtaaacaattttcaggacattcctgtgctagaagttttcaaaggatatgaggattta
attacagaccttggtgatcccatgaacatatgggaagagaataattttgaaaatggcttc
tttttaaatatcactacaaaagttctcgagaacaaggaagttcaaaagagactactatct
aagggaaaggcacaatacgatttgattatattagaagctctgagggctgatgttctttat
gcctttggtgcacattttaatgcccccattataggaatttccacatttggaaccgattgg
gatattgacaaattggtaggcaatacgtcgcccctttcgtacatacccttgattacagcg
ggattgagcgatcgcatgacattttcggaacgaatatctaatttcgttaagacatcggtg
gcctggttgaattataactgggttcatatgccaaagcatgaagaactctacaagaaatat
ttccctcatattgctgataaatttcaattatcggaattggctaagaatatttcactggtc
ctacttaatcaacatttctcgttgagttttccacgtccctatgttccaaatatgattgag
gtgggtggtctgcatatagctcataagccagctgcattgcccaaggaaatggaggatttc
attcagggtgctggcaaggctggtgtgatctacttttctctcggctccaatgtaaagagt
aaggatttgcctgaggaaaaacgaagaatgctacttgaaacgtttgctagcttacctcaa
cgagttttgtggaagtttgaattagatcacttgcctgagaagcccgcaaatgtgtttata
agcaaatggtttccacagcccgatattctggcacatcctcaggtaaaattatttataacc
catggcggcttattatcgaccattgagagtatacatcatggcaaaccagtactcgggcta
ccatttttctatgatcaattcctgaatattgcccgtgcgaaacgggctggctttggctta
ggcttgagtcacgctgacatgactggatccgaatttaagacaaccatagagcgattgtta
aatgaaccaagttttatggcaacggctcaagcgatgtcagcacgctaccgagatcaaccg
atgagtccacaggacacagccatatggtggaccgaatatatcctgcgacacaaaggagct
tcacatatgcgagtagccgcccaagatttgaacttctttgcctatcacagcttagatgtg
ctggcaactctaattggtggagcttttgtagcaattggtttagttttattcgcattaaca
aaagttcttagatttactcagggcacaaaaactaagcaaaagactatgtaa

DBGET integrated database retrieval system