KEGG   Drosophila willistoni: Dwil_GK13515Help
Entry
Dwil_GK13515      CDS       T01067                                 

Definition
GK13515 gene product from transcript GK13515-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dwil_GK13515
Protein kinases [BR:dwi01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Dwil_GK13515
Protein phosphatases and associated proteins [BR:dwi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dwil_GK13515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 406 aa AA seqDB search
MSHQSQFNHNHVLRPTENTNSMPVSRPKPDTGSAAAVAAAAANMKKQLLLTKKPTDENSV
PGGAPAHKTVTSSSTHPGILSRPGGVIQKPTSNTIAKADTGFAVPAPVGEAKKCIEKTTT
AAGSCTGATKKTETDIPPRPKKTWELSNFDIGRLLGRGKFGNVYLAREKESQFVVALKVL
FKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQA
QPLKRFDERQSATYIKSLCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEP
NSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCYELLVGHAPFFSKNYDETYKKIL
KVEYKLPEHISKAATHLISKLLVLNPAHRLNLDQVMVHPWIIAHTQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcagtcccaatttaatcataaccatgtgcttcgtcctacggaaaatacaaat
tcgatgcctgtgtccaggccaaagccagatacaggatcagcagctgcagtggcagcggct
gcggctaacatgaaaaaacaattattgctaacaaaaaagccaactgatgagaacagtgta
ccaggcggcgctccagcccataagactgtgacttcaagctcaacacatcctggcatcctg
tccagacctggcggagtaatacaaaagccaacttccaataccattgccaaagcggacacc
ggttttgcagtgccagctccagtaggcgaggcaaagaaatgcattgagaagacaacaact
gcagcgggatcctgtacgggagccaccaaaaagactgaaactgatattcccccaagacca
aaaaaaacctgggagctaagcaactttgatattggtcgtctattgggtcgtggtaaattc
ggaaatgtctatttggcacgcgaaaaggaatcccaatttgtggtggctctcaaagtattg
tttaaacgccagatcggtgaatcaaatgtcgagcatcaagtgcgacgtgagatcgaaatc
cagtcgcatttgcgacatccgcatattttacgtttatatgcctatttccatgatgatgtg
cgcatctatttgatcttggaatatgctccacaagggacactcttcaacgctttacaagca
cagcccttgaaacgtttcgatgagcgccaatcagccacttatatcaaatccttgtgttcg
gctttgttgtatctgcatgaacgtgatattatccatcgcgacatcaaacctgagaatctc
ttgctgggccacaaaggcgttttaaagattgccgatttcggttggtcagtccatgagccg
aattccatgcgcatgactctgtgcggcactgtcgattatttgccaccagaaatggtccag
ggcaaaccgcataccaagaatgtcgatctttggagtttgggtgtgctgtgctatgaactt
cttgtgggtcatgctccgttcttttcaaaaaactatgacgagacgtacaagaagattctg
aaagtggagtataagttgcccgagcacatttcaaaggctgctacacatttgatatctaag
ttgttggttctcaatccggcacatcgtttgaatttggatcaagttatggtgcatccatgg
ataatagcgcatactcaataa

DBGET integrated database retrieval system