KEGG   Drosophila willistoni: Dwil_GK13659Help
Entry
Dwil_GK13659      CDS       T01067                                 

Definition
(RefSeq) GK13659 gene product from transcript GK13659-RB
  KO
K15293  
protein unc-13 A/B/C
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 3205 aa AA seqDB search
MQPTQANFIGSEAVMQMSMSRSNPATGSMVSIRSEQQLSQIYNSQQHSDYIISDYMDKIA
TRISLLETELKFAWRALDLLSTEYGKIWTRLEKLENISVEQQSVVSNLMGLIASAKPHHN
VDIDLDLDAQATFPKFLPLGMDVNSHMVEDKTEKHMSNLNLDTGVSVTTEDDGLGRTSGF
FMDSEYGLGADQCDEFFLDYEPGPLNDNDRDVDLEADQIDFDNEHKWLLNTDVDGSKSRQ
KLYSDSDIILYQQQQQVLANNARADLLMEFLNGRRVLQEVAMGSAAGASASTASSSLLNL
AQLTKKSRTHGHRHHKGRSHDEADNHCLTVTDSDSGAALHGMDSMSVPATNQEELDELID
EANFFRLAAFRTGEGGKQVLPIEDTGGTAQTKVLNSEMNETFYKTLNEAYRDDNLSSEIS
KVEHLLQQSGAAHEHITTLNGGRSTSSLMMIHEGNEDDALDAELALTASQVSAPLRTSKL
IKSGVCSDQQVGKESRKHRKKKHYKNEMDMINNLKCILAQSQSTSNKDKNMNSLSDQQHS
QGNKTLTKEKNDNLKSYLDDSDSLCPDQNIAILDTITELMIREINKIEDLQSLNASQIRQ
LRQEIRSEVTFFEKLNQVDKNLTLLLLNPVTMGEEMRRLHVKEPNCKFDLVIKKFNKNID
TLKKLVGNSFDEFKITSKNSNCTMLSIPDPNETGVGYSAHLLRNKSDLDEQLKLLETQEI
EINRKKAIEQITNAHGKKVNNSDTEEECRVQQRYIECSPCPNPNHIKHLSSSASNIYNQD
EYIKSLKKSLERHNSMLFLLHLQNPDKHKKISDLDEIFQLDRNRESQSPPPPAPYDNGFE
DIIPVGRDDGIGTESSNPFTSDQRQQTHQQQQQPHVSPRQAKSDSGLSSMSGWSPNSPVP
ISIQSCNPFLNKYKDINTEMLQLQLHLGYPYGLVDFRDESTANSESRPEGGYVFSEENLN
YIQELSKNMPICSAYENKSIFNVNVNKEKEFSTVDELLKWDQQTDKQETDCNIEPKLPSL
QRPPSATNSSEHSANIKCRMPDLLKNQLSISATKSSSKRRIIKPDKQFAELRSLRGYDET
DIDHLERQDLTRKPYLTDRLVYYPSSNGIADYNSSRNLDFMGLQQSQQQHPQQIGFLAQS
HAISSPSINAVEFPIEYFSSESTSAEPMSKNSHRDPSIEVPHKPTKVWNKLNNLLPENLK
LKRPAKYARSQSLPGDVEGQESEVQGRGQVSSYPLIGHRRSQKGNRCESAGNEVVSGSHL
DLPKRIQKIPLRIIQRATASHSHSLSCSNTNAAQKKRSFSAKMNHLMQMAKTYKRQSFGP
RPVSSISDSETDIPGFTSSDNDDWSANENSSRHHTNSDPAIDDYDEEDVDSLIPDDGEAE
NIDYNNSKMVVTGYGESNEEGESHNVFAIIGDLKKSEVLSTSNLQLQQRAVMQNNINISE
QIPEKTLESNETPTSEAKACLEKSSSLYVGDQDADNGVTCMQSEVKINVPLLHVATTAAS
TPTFPHVSPQNKIVNVQPQATNRGNSNIVGGSFFAAHQSLDIPSSLGHGSRDDDDNRSQH
SGRTLSSSRRQSTEDSIDTDDEYFCYELRQLEELEQQRTAEAEQRNNKDVLLSQIGQLTI
DEDGFCYPELSAELSPDEGVRQNMSKVLNELKCVVRLQPDILIGSAAGNQTGFTTPNVAA
VNSGDGVKKQKPTEKFARVCDMHSAWQDVNGDLQQAGSDLETHEDTESIRKEERILGEKH
QQKRLKKKRRDREHVPSSSSSCESENDFKDSNLKKPSQKSKIVITAALKTTAVESVSDQK
TIEKCSQESASSSATSGPDTPAELSDEIATDAAPDEERIFLALLSKNGEPAENGDPTDIC
GDDFNLFEESKATSSQPEMESELEQIPEAITSTNGIVSKSNPKKLLSQDSSIDVTQSSIG
NGAAASFGSSKWKLLKTLKERKIEERNNQDKIKEDVLSKDKEKNGGGTGDVGIRTNGHPG
DNPFYSNIDSMPDIRPRRKSIPLVSELVLKTMAATKRNAGLTSAVPRATLNDEELKMHVY
KKALQALIYPISSTTPHNFVLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKD
LLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKHREREKPEIFELIRAVFSIEEKSHT
GHMKAVKQSVLDGTSKWSAKIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQ
ELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSG
EMDVWYNLEKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGM
VKLPTQKGDDAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMS
TLLANINAYYAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPAS
SPEKLMDLKSTVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYEL
YNREFQVDPNEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNI
GQLSAASMWHLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVP
DYPAWFEPFVMQWLNENDDVSLEYLHGAFNRDKKDGFQKSSEHALFSNSVVDVFTQLTQC
FDVVSKLECPDPEIWKRYMRRFAKTIVKVLIAYADIVKMEFPEHMRDERIACILMNNIQQ
LRVQLEKMFESMGGDKLEEDAANILKELQQNLNSALDDLACLFAISLEPRITQSVRELGD
MLLSIKGGSGNLVAGNQAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLK
ELWKIVMRILEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVK
SALSGVMDMSKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYA
LSLYTQMTDTLIKTFISSQVHEVDPENAEESVGEISVQIDLFSHPGTGEHKVTVKVVAAN
DLKWVIPSGMFRPFVEINLIGPHLQDKKRKFATKSKSNNWSPKYNESFNFAIGNEEQLDF
FELHICVKDYCFARDDRLVGVAVIPLKDISEKGSVACWLPLQRRIEMDETGWTILRILSQ
RSNDEVAKEFVKLKSEIRQEPTMGT
NT seq 9618 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgacacaagctaattttattggtagcgaagccgtcatgcaaatgtcgatgtcg
aggtcgaacccagctacgggcagtatggtgtccatcagaagtgagcagcagctttcccaa
atctacaattcacaacaacactcagactacataatctccgactatatggacaaaatagca
actaggatcagcttgctggagactgagctgaagttcgcttggcgcgccttagatttatta
tccaccgaatacggtaaaatatggactcgcttagagaaacttgaaaatatttcggttgag
cagcagtctgtagtaagcaacctcatgggtcttattgcatcagctaagccacaccataat
gtggacatcgatcttgaccttgacgcgcaagcaacttttcctaaatttcttccgttaggt
atggatgtaaattcacacatggttgaagacaaaaccgaaaagcatatgtccaacttgaat
ttagatactggtgtttccgtaactaccgaagacgatggcctcggacgtacttccggtttt
tttatggactccgaatatggactaggagccgatcagtgcgatgaattttttttggactac
gaacctggtcctcttaacgataatgaccgggacgtggatttggaagctgaccaaatcgat
tttgataatgagcacaaatggttgctaaatacagacgttgatggtagtaaatctcgccaa
aagctttattcggattcggatataatattgtatcaacaacagcagcaggttttggcaaat
aatgccagggccgacttgttaatggaattccttaatgggcggcgcgtgcttcaagaagtt
gcaatgggatctgcagctggcgcctctgcatctactgcatccagtagtcttttaaacttg
gctcaactgacaaaaaagagtcgcacacatggacatagacatcacaaaggtcgttctcac
gatgaagcagataaccattgcttgacagtaacagactccgattccggcgcagctttgcat
ggaatggattctatgtctgtgcctgcaaccaatcaggaagaactagacgagcttattgat
gaggccaatttttttcgcttagccgcctttagaacgggcgaaggagggaagcaagtactg
cccattgaagatactggtggaacggcccaaacaaaagtgttgaatagtgaaatgaacgag
actttttacaagaccttaaatgaagcatatcgtgatgataatttaagctcggaaatatca
aaagtagagcaccttcttcaacagtctggggctgctcacgaacatatcactacattaaat
ggtggacgatcgacatcgtcccttatgatgatccacgaaggtaacgaggatgatgcttta
gacgccgaacttgcacttactgcatcgcaggtgtctgcccctctaagaaccagtaagctg
attaagtcaggagtttgctcagatcaacaagtaggcaaagagtcgcgaaagcacagaaaa
aagaagcactataaaaacgagatggacatgattaataatctcaagtgcatacttgctcaa
tcacaatccacatctaacaaagacaagaatatgaattcactttcagatcagcagcactca
caaggcaataaaaccttaaccaaagagaaaaatgacaatctgaaatcgtatctcgatgat
tcggacagcttatgccccgatcaaaatatcgctatattggataccataactgaactgatg
atacgtgaaataaataaaattgaagatttgcaatcattaaatgcttcacaaatacgtcag
ttgcgtcaggaaattcggtcggaagttaccttttttgaaaaacttaatcaggtagataaa
aacttgacactgctgctacttaatcctgttacaatgggagaagagatgcgccgtcttcac
gtaaaagaacccaattgtaaatttgatcttgtgataaagaagtttaacaagaatattgac
acgctaaagaaacttgttgggaattcatttgatgagtttaagataactagcaaaaacagt
aattgcactatgctctctatacccgaccccaatgaaactggagttggctatagtgcacac
ttgcttcgtaataagtcagacttggatgagcagctaaagttactggagacgcaggagatc
gaaataaatcgaaaaaaagccatcgagcagataacaaatgcacatggaaaaaaagtgaat
aactccgacaccgaagaagaatgtagagtacagcagaggtatatcgagtgcagtccatgt
cccaatccaaatcatatcaaacatctgtcaagttcggccagcaatatttataatcaagat
gaatacataaagtcgctaaaaaaaagcttggagcggcataacagcatgctcttcctgctg
catcttcaaaaccctgataaacacaaaaaaataagtgatttggatgaaatatttcagttg
gatcgaaatcgagagagtcaaagtcccccacctcctgctccctacgataatggatttgaa
gatataattcctgtcggaagggatgatggcataggcacagagtcatcaaatccttttact
tccgatcagagacaacagactcaccagcagcagcagcagccgcacgtttcaccgcgtcaa
gctaaatctgattcgggactgtcctctatgagtggctggtcaccaaattcacctgtaccc
atcagcatacaaagctgcaatccatttttaaacaagtacaaagacatcaatacggaaatg
ctacaactgcagttgcacttgggatatccatatggattggtcgacttccgtgatgaatca
accgccaacagtgaatcgcgtcccgaaggtggatacgtattttccgaagaaaacttaaac
tatatacaggagctatcaaaaaatatgcctatttgttcggcctatgaaaacaaatccatt
ttcaatgttaatgttaataaagagaaggaattttccacagtagacgaattgctaaagtgg
gaccagcagacggataaacaagagaccgattgcaacatagagcccaaactcccatcactt
caacggcctccgagtgctacgaattcttctgaacatagtgcaaatattaagtgccgaatg
ccagacttgctaaagaaccaattaagtatttcagcgaccaagtcatcctcaaagagaaga
ataatcaagccagacaaacaatttgcagaattgagatcattacgaggttatgatgaaact
gatatagaccacttggaacggcaggatttgacgcgtaaaccttatttaaccgaccgtctg
gtatactatccatcatcaaacggcattgcggattataacagcagccgaaatctggatttt
atggggcttcagcagtcacagcaacagcatccacaacaaatcgggttcttggcgcaatcc
catgcaatcagttcgccgtcgattaatgcggtagaatttcctattgaatacttttccagc
gaatctacgtcagctgaaccgatgtcgaaaaattcccatcgggatccatctatagaagtc
ccacacaaaccaacaaaagtgtggaataagcttaacaacctattgccagaaaatttgaag
ttaaaacgcccagccaagtatgctcgatctcaatcattacccggtgatgtggaagggcaa
gagtcagaggtgcaaggacgtggccaggtgagctcgtatccgttaatcggtcatcggcga
tctcaaaagggaaataggtgtgaaagcgctggtaatgaagttgtaagtggcagccactta
gatttgcctaaacgcatacaaaaaataccgttgcgcattatacaaagagccacagcctca
cactcccattcactatcgtgttcaaatacgaatgcagcgcaaaagaagcgttcgttttca
gctaaaatgaaccatctaatgcagatggcgaagacgtataaacggcagagctttggtccg
cgccccgtctccagcatctccgattccgaaactgacataccaggcttcacttcgtcggat
aatgatgattggtcggcaaatgagaactcctctcggcatcatacgaactccgacccggcc
atcgatgattacgacgaggaggatgtcgattcccttatccccgatgatggggaggctgaa
aacatcgactataataacagcaaaatggttgttactggatatggtgaatcaaatgaggag
ggcgagagtcataatgtatttgccatcattggagatttaaagaagtcagaggtcctttcc
acaagcaatcttcaacttcagcaacgtgctgttatgcaaaataatattaacatatctgag
caaattccagaaaaaactttggagagcaatgagaccccgacttctgaagcaaaggcatgt
cttgaaaaaagtagttccttgtatgtcggcgaccaggacgctgacaatggcgtgacctgc
atgcaaagtgaagttaagataaacgtacccttgttgcatgtagcaacaacagcagctagc
accccaactttcccccatgtctcgccccaaaacaaaatagttaatgtacaaccgcaagca
acgaatcgtggcaatagcaatatagttggtggttcttttttcgcggcacatcagtctcta
gacattccaagctctttgggtcatggttcacgggacgatgatgacaatcgtagtcagcat
tcgggccgcactctttcatcatctcggcgtcaaagtacggaagacagcatcgatacggac
gacgagtacttttgctacgagttacgacagctcgaggaactggaacagcaacgtacagct
gaggcagaacagcgcaacaataaagacgtgctattgtcgcagattgggcagttgacaata
gacgaagacggtttttgctatccagaactgtctgctgagttgtcgccggatgaaggcgtt
aggcagaatatgtccaaagtactaaatgaacttaagtgcgtcgttagactacagcccgac
atattaattgggtctgcagccggaaatcaaaccggattcacaacaccaaatgtagctgcg
gtaaatagtggagatggtgtgaaaaagcaaaaaccaactgagaaatttgccagagtctgt
gatatgcatagtgcatggcaggacgtgaacggcgatctccaacaggctggttctgacctt
gaaacgcacgaagatacagaatctattcgcaaggaggaacgtatacttggcgaaaaacac
cagcaaaaacgcttaaaaaaaaaacgacgcgatcgcgaacatgtacccagctcaagttca
tcgtgtgaatcagaaaacgatttcaaagacagcaatctaaagaagccgtcacaaaaatcg
aaaattgtcattaccgccgctctaaagacaactgctgttgaatcggtatcggaccaaaaa
acaatcgaaaaatgttcacaagaatcggcgtcttcaagcgcaacctccggtcctgataca
ccagcagaattaagcgatgaaattgccactgacgcggctccagatgaggagagaattttc
ttagccctactctcaaaaaatggagagcctgctgaaaatggggatcccactgacatttgt
ggcgacgatttcaatttgtttgaggaaagcaaagctacttcaagtcagcccgaaatggag
tcagaattagaacagattcctgaggccataacatcaacgaatggcatagtcagcaaatca
aatcccaaaaaacttttaagtcaggactctagcatcgacgtaacgcaatctagtattgga
aacggcgcagccgccagttttggtagcagtaagtggaaattgttaaagacacttaaagaa
agaaagatcgaggaaaggaataaccaagacaagatcaaagaagatgtattaagcaaagat
aaagaaaagaatggtggcggcactggcgatgttggaatacgcaccaatggacatcctggc
gataatccattttatagtaacattgacagcatgccagatattcggcctcgtcgaaaatcc
ataccccttgtttctgaactggtgctcaagacaatggcggcaacaaaaagaaacgctgga
ctaacatctgctgtgccgagggctactcttaacgatgaggaattgaaaatgcatgtctac
aaaaaagcacttcaggcgctgatctatccgatttcctcaacgacacctcataactttgtc
ctctggacagcaacgtcgccgacttattgctacgaatgcgagggtctgctttggggaatt
gctcgccagggcgtgcgctgtacagagtgcggcgtaaagtgtcatgagaaatgcaaggac
ttgctgaacgctgactgtctacagcgtgctgctgaaaagagctccaaacatggagccgag
gacaaagcaaattctataattaccgccatgaaagaccgcatgaagcatcgagaacgagag
aagccggaaatctttgaattgatcagagccgtgttcagcattgaggagaagagccacacg
ggccacatgaaagctgtgaagcagagtgtcctggatggcaccagtaaatggtcggccaaa
atagcaatcacagtgatttgtgctcaaggcctgatagcgaaggataaaagcggtaccagt
gatccttatgtgacggtgcaggttagcaaagtcaaaaaacgaacgcgcacaatgccccag
gagctaaaccctgtgtggaacgagaagtttcactttgagtgccataactcgtcagaccgc
atcaaagttcgcgtttgggatgaggacaacgatctaaagtcaaagctgcgtcagaaactg
actcgtgaatcagacgactttctcggacagacaataatcgaagttcgcactctatccggt
gaaatggacgtgtggtataatctggaaaaaagaactgacaaatcagcagtatcaggagct
attcgccttcacatatctgttgaaataaaaggcgaagaaaaggttgcaccctatcacgtg
cagtacacttgcctccatgaaaatctttttcactacctttgtgaggaaaacagcggcatg
gttaaacttccaacacaaaaaggcgacgatgcctggaaactgtatttcgatgaaatccct
gaagaaattgtagacgagttctctatgagatacggcatagagaatatataccaggcaatg
acgcactttcactgtctgtcggctaagtatctttgcccaggtgtacccgccgttatgagt
acgctattggcgaacataaacgcgtattacgcccacaccaccgcctcttctgcagtttca
gcaagtgaccgctttgcagcaagcaatttcgggaaagaaaaatttgttaagttgttggat
cagttgcacaattctctcagaatcgacctgtctatgtatagaaataattttccggcatcg
agtccagaaaagctgatggatttgaagtctacagtggacctactaacaagcataacattt
ttccgcatgaaagtacaagaactgtccagtccaccgagggcaagcacggttgtcaaagat
tgcgtcaaggcctgtctacgatccacgtaccaatttttgtttgaaaactgctatgaactg
tacaacagggaatttcaggtggacccgaacgaagctaaacgtgcccctgatgaccacgag
ccaaagttagacagtgttgacttctggcataagctaattgctctaattgtgtccgtcatt
gatgaagacaaaaacagctatggcactgtgctaaatcaattcccacaagagctgaacatt
ggccaattgtcagcagcatctatgtggcacctctttgctgttgatatgaagtacgccctg
gaggagcacgaacagcatcgtctttgcaaatcgtccgcttatatgaacttacactttcgg
gttaaatggttatatagcaattacgtaaaggaggtgcctccatacaaaggtgccgttcct
gactatcccgcatggtttgaaccatttgtgatgcaatggttaaatgagaatgatgatgtc
tccttggaatatcttcacggcgcctttaatcgagacaaaaaggacgggtttcaaaagagc
agtgagcacgcactgttctccaattcagtagtcgacgttttcactcaattgacgcaatgt
ttcgatgttgttagcaagctcgagtgtcctgatccagaaatttggaaacgttacatgagg
cgttttgctaaaacaatcgtaaaagtgctaatagcctatgccgatattgtgaaaatggag
tttccagagcatatgagagacgaaagaattgcttgcatccttatgaacaacatacagcaa
ttaagagtacagttggaaaaaatgtttgagtcaatgggtggtgataagctagaagaagac
gctgcaaacattctaaaggaattgcaacaaaatttgaattcggctctagacgatttagct
tgtctttttgccattagcctggagcctcgcataacacagtcggtccgggagctgggtgac
atgctgctctctataaaggggggcagtggaaaccttgttgccggcaaccaagctgcacaa
cgcaacgcagttgctgttgaagccgacgaggtgctgcgacccttaatggatcttttagat
ggttctttgaccttgtacgcccagtcatgcgaaaaaaccgtgttgaagcgcctgttgaaa
gagctttggaagattgtaatgcgtattttggaaaagacaattgtgttgcctccaatgacc
gataagactatgatgttcaaacacctcaccgacaatgctaaaaatctggcctctaatgct
aaaatagaggatatgggtcgtctatttaagtcgcacatggccggaaagcaggacgtgaaa
agtgcccttagtggtgtcatggacatgtcaaaggaggtggaaaagaatctttcacccaaa
caatgtgccgtgcttgacgttgccttagatacaatcaaacagtacttccatgccggcggc
aatggacttaagaaaacatttttagagaagtcgcccgagttgcagagtttgcgatacgcc
ctcagcctatacactcaaatgaccgacacattgattaaaacattcatatccagtcaagta
catgaagttgatcccgagaatgctgaggaaagcgtcggcgagatttcagtccagattgat
ctgttttctcacccaggtaccggagagcacaaagttactgtgaaagttgtggctgccaac
gatttgaaatgggttataccttctggtatgtttcggcccttcgtcgaaatcaatctgatt
gggccacatttgcaggacaaaaaacgaaagtttgccactaaatcaaaatcgaacaactgg
tcaccaaagtacaatgaatcatttaacttcgccattggaaatgaggaacaacttgacttc
tttgaactacacatttgcgtgaaagactattgtttcgcacgagatgatcggttggtgggt
gttgccgttattccactaaaggatatatctgaaaaggggtcggtagcgtgttggttacct
ttgcaacgacgaatcgagatggacgaaactggttggacaattctacggatactttcgcag
agaagtaacgacgaggttgccaaggagtttgtgaagcttaagtcagagattcgtcaggag
ccaactatgggtacttaa

DBGET integrated database retrieval system