KEGG   Drosophila willistoni: Dwil_GK13659Help
Entry
Dwil_GK13659      CDS       T01067                                 

Definition
GK13659 gene product from transcript GK13659-RA
Orthology
K15293  
protein unc-13
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3016 aa AA seqDB search
HYAPQDYFYNNKNDALSLSTGTPIDNCTIYNNAYDDEARAQNQNPNQNVSYEHDAYQWTS
SDISDALLDERSNSQSVGYDYVSDYYGNEEDNTQNLGREHVETGDYWEENKAIIKTGYKD
EYEYGQGEYCSPKLLPTFPQSKVGSDIGMQGTYARRCRGQPFDAHADGVKSRMLPQTVPY
SNVYTNSFNGHAGGAPSTCGNDRTPTMPLRVLPQLRSRSVLNQQILEMDAYRPHSSGNLG
NSFAMVDTVSTTEVATTTQNDMYDVFGQESRPYTSMLPLNYSDYHSEYGYNADNLSTYSD
TPPTSIAQHKQQQRKVSLMMAMTTASVIASGETRVAVQNSKNQNQPTSSHPEAYPNPLYD
FFGNTIGGPSARLEIVFCSSAMTTTTQASTTSTTNGATVSLTSTRKLPKRLPTPRCKTAV
NSVSTSGEISGFSIDHPQLPISAQAEKAVRTKQLPKIPVPQHEIHSHSTLGSDSNTMGIA
KDVLPLNSVLPLPSASEPAHTYRSSSEVDTSRFATSVATTSKSSKSDREVYSPVHFCQDF
TQLDTRTSSHLNINDLAVQKSVTSAESWLPSTVLSDSYSSSKLLVDADKPSVENTLSDND
LSSRTLQTVPISEKLSLTTTSITTSTAPTTIFQPETCTLDISEYLKPYTLEKFSFPSDIQ
NNYIAITTIAQSHPSQPSNVTFETLQPSPTLGSDMSYPETTWMTSAVNISCKAFAGADGS
SPSNEALSPTKTKTSATIATSLSHSSSSYLISSPNDTRLHDKLAIKTNNTPSPVSPDLVD
MPSCWSYTQSVFTTTASVPPLMPRVVTSADLTLVSMPSVSDPPPVSQSTPLASPTLTYVD
YMKKFELPELPPILQICTLDSSAIESVPAAVNFDNTDKANEGDNATPLETFSTPMTFYNK
EPLVYYTNSNATGTTASVTARFETISTLPITETIADTTLKDETGTKLSSVEPNVEILTTS
SMSPPLCPKAFDDNFYDSFNVDLTVLTESITHVDSHISPTEKPSHCTEITNNRSYDNQED
FSKADSSSDADKLLNSKQGGYYKPPEKYQPTTQSQPPIPKGSSSPLTPQKAKTVTSAASS
VLGGLSKGIKGGLGLDGVFSGSSSTEMSQPQVNNSGKKVFGFGIASKFVPSVGGLLNSSN
KFVPTEPEKETSAIVATTTSAISHEETAFSNVQLLVATTASTNQTSTAHINSNNSNDLPI
NFVTEVCPITKTQISKEVAYHDNYDDLQFGNDLTSVDNSYEYDYTGYCDNGEIIYSYEDP
YKEVENNINVEMNAQYISLSSKPMGEATSLQKPLGLRSSDLPPPPVEAPITSTSTNSASS
GSGVSTATSGMFGSILGKAAAAVQSATQAVNQGASSVALAVAQKAVSSSDQKVTAQSHTV
MDTPGIETNNGGYNHPLLIQEPLSSQYPNFGDDYENRNVQAFANDDNNYYSNGNQSHSGV
ENVEAGPSIPPSGVSTKLLPTVPPAGSTGKKLPTINGKSGLLIKQMPTEIFDDESDIEIE
LDALADHDRNYGIDGEQDDYYLDNQQTTPSIRPNGYYEHVGGGYDYREDYFNEEDEYKYL
EQQRQQQQQRQLKNTQQQQHKMLLSHNQTSLDYIDEGQDEDFTYDNYQSEEDSGNYLDES
SSGSVAIVDGRKSQKPVHTTRETLLAEADTSATGLNTFKSTDISLQLSSIHQQIKKQDSI
IIDESEPRKIDPCENRRLSGSVPTQRSLDLSPPEEEANDQLADLADLSRVKSQKKRVLVR
GETEEVVSGHMQILRKTEITARQRWHWAYNKIIMQLNNGGGTGDVGIRTNGHPGDNPFYS
NIDSMPDIRPRRKSIPLVSELTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIY
PISSTTPHNFVLWTATSPTYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQR
AAEKSSKHGAEDKANSIITAMKDRMKHREREKPEIFELIRMTFGVDPDTHIDSLEQAEHA
TVEGTSKWSCKLTITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEK
FHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLE
KRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPTQKGD
DAWKLYFDEIPEEIVDEFSMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAY
YAHTTASSAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLK
STVDLLTSITFFRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDP
NEAKRAPDDHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSAASMW
HLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPF
VMQWLNENDDVSLEYLHGAFNRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLEC
PDPEIWKRYMRRFAKTIVKVLIAYADIVKMEFPEHMRDERIACILMNNIQQLRVQLEKMF
ESMGGDKLEEDAANILKELQQNLNSALDDLACLFAISLEPRITQSVRELGDMLLSIKGGS
GNLVAGNQAAQRNAVAVEADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRI
LEKTIVLPPMTDKTMMFKHLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDM
SKEVEKNLSPKQCAVLDVALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTD
TLIKTFISSQVHEVDPENAEESVGEISVQIDLFSHPGTGEHKVTVKVVAANDLKWVIPSG
MFRPFVEINLIGPHLQDKKRKFATKSKSNNWSPKYNESFNFAIGNEEQLDFFELHICVKD
YCFARDDRLVGVAVIPLKDISEKGSVACWLPLQRRIEMDETGWTILRILSQRSNDEVAKE
FVKLKSEIRQEPTMGT
NT seq 9051 nt NT seq  +upstreamnt  +downstreamnt
cattatgcgccgcaggattacttctataataacaaaaacgatgccttatctctgtcgact
ggaacaccaatcgacaactgcaccatttataacaacgcttatgacgacgaagcacgggca
cagaaccagaacccgaatcaaaatgtttcatatgaacacgatgcgtaccaatggactagt
agcgacatttcagatgccttactagatgagagaagcaacagccaaagtgtcggttatgat
tatgtttccgactactatggcaatgaggaagacaacactcaaaatcttggtcgggagcat
gtagaaactggagactattgggaggagaacaaggcgataattaaaacgggatacaaagac
gaatacgagtatggacaaggggaatactgctcaccaaagctgctacccacatttcctcaa
agtaaggtcggatcagacattgggatgcaaggtacgtacgcaaggagatgcagaggccag
ccgtttgatgcacacgctgacggtgtcaagagtcgcatgttgccgcagacagttccctac
tcgaatgtctacactaacagcttcaatggacatgctggtggtgcaccgtcaacatgcggc
aatgacaggacgccaacgatgccattgcgggtcttgcctcaattacgatcacgctctgta
ttaaatcagcaaattttagagatggatgcctacaggccacatagcagtggtaatttaggg
aatagttttgccatggtggacacggtttcgacgactgaagtagccaccactacccaaaac
gacatgtatgatgtctttggccaagagtcgcgaccttatacctctatgttgccgcttaac
tacagcgactatcacagtgaatatgggtacaacgccgataacctttccacctatagcgac
acaccgccgacaagcatcgctcagcataagcagcaacagcgcaaggtctccctaatgatg
gctatgacaacggcttcggtaatagcgtctggagaaactcgggtggctgttcagaattca
aaaaatcagaatcaacccacgtcaagtcatccggaagcataccctaacccgttatacgac
ttctttggcaacacaatcggaggaccttcagccagactggagatagtattctgcagtagt
gcgatgacgacaaccacccaagcttccacaacctccactaccaatggggcgacagtgtct
ctgacttcaacaagaaaattgccaaaacgccttccaacaccacgatgcaaaacggcggtg
aattcggtgtcaactagtggcgaaatatcaggtttctcaatagatcaccctcaactgcct
atatcagcgcaagcggagaaagcagtacgcactaaacagctaccgaagatacccgtacca
caacatgaaattcattctcattcaacactcggttctgactcaaataccatgggtattgcg
aaggacgtattgccattaaattcagttttaccattgccatcagcatccgagccagcacat
acatatcgttcatcgtcagaggtagacacatcccgttttgcaacatcagtggccacaaca
tccaaatcatcaaaaagtgatagagaggtgtacagtcctgtccatttctgtcaggatttt
acccaattagacactagaaccagtagccatttaaacattaatgatctagctgttcagaaa
tccgtcacctctgctgaatcatggctcccatctacagtactctcagattcatattcttct
tctaagcttttggtggatgcagataagcccagcgtagaaaatacattgtcggataatgat
ttatcatcacgcactttgcaaacggtgccaatttccgaaaaactctctttaaccaccact
tcgataacgacatcgacggcgccaacaacaatatttcaacctgagacatgtacccttgac
atatctgaatatctaaagccttatacattagaaaaatttagttttcccagtgatattcaa
aataattacattgcgatcaccacaatcgcacaatcacatccttcacaaccaagcaacgta
acttttgaaacattgcaaccttcgccgacattgggctctgatatgtcatatcccgaaact
acatggatgacaagtgctgttaatatctcctgcaaggcgtttgctggtgctgatggctct
agtccatctaatgaggcactgagcccaacaaagactaagacgagtgcaactattgccact
tcgttgagtcactcttcttcctcgtatttgattagcagtccaaacgatactcggttgcac
gataaattggcaatcaaaacaaataataccccaagccccgtctcccccgatttagtagac
atgccatcatgttggagctacacccaaagcgtgttcacaaccactgcttccgtgccgcct
ctaatgccaagggttgtcaccagcgcagatttaactttagtttcgatgccatcagtgtcc
gaccccccaccagttagccaaagcacaccactagcttcacccacactcacatatgttgat
tacatgaaaaagtttgaactaccggaactgccaccgattcttcaaatttgtaccctcgac
tcatctgcaatagaatctgtacctgctgcggttaatttcgataatacagataaggctaat
gaaggggataatgctacaccccttgaaacattttcgactccaatgactttctataacaag
gagccacttgtctactacactaacagcaatgcaacaggcaccactgcatctgttactgcc
agatttgagactatttccacattgccaataactgagactatagcagatactacattgaaa
gacgaaacaggaacaaaattaagttcggtagagcccaatgtagaaattttaacaactagc
tcgatgtctccaccattgtgccccaaagcgtttgacgataacttctatgatagtttcaat
gttgatctaacagtgctaacagagtccataacgcatgttgacagtcatattagcccaaca
gaaaagccttctcattgtactgagattacaaacaacaggagttacgacaatcaagaggat
ttcagtaaggcagactcgtcaagtgatgctgataagttgttgaattcgaaacagggcgga
tactataagcccccagaaaaataccaacctacgacacaatcccagcccccaatcccgaaa
ggttcttcatctccgttaactccacaaaaagccaaaacggtgacatcagccgcgtcaagt
gttctaggcggactttcaaaaggaataaaaggtggtcttggccttgatggagtttttagt
ggcagttcctctacggaaatgagtcaacctcaagtcaacaattcggggaagaaagttttt
ggttttggcatagcctctaagtttgtgccaagtgtcggaggactgttaaacagcagcaat
aaatttgttccaaccgaacccgagaaagagacatctgctatcgttgcaactacaacttcg
gcaatcagccacgaagaaaccgctttttcaaatgttcaactcttggtggctactacagct
agtacaaatcagacttccacggcacatataaattcgaataatagcaacgaccttcccatt
aactttgtgaccgaagtctgtccaataacaaagacacaaataagtaaggaagttgcttat
cacgataactatgatgatttacaattcggcaacgacttgaccagcgtggataactcctat
gagtatgactacaccggatattgtgacaatggtgaaattatttacagctacgaagatccc
tacaaagaagttgaaaataatataaacgttgaaatgaacgctcagtatatatctttgtct
tccaaaccaatgggcgaagcaacttccttacaaaaaccacttggattaaggtccagcgac
ttaccgcctccccccgttgaggcgccgataacttccacatctacgaatagtgcttcatca
ggcagtggggttagcacagccacaagtggcatgtttggctcaattttgggaaaagctgcc
gctgctgttcaatcggctacgcaggcagtaaatcaaggtgcttcttctgttgcgttggct
gtcgcacagaaagcagtatctagctcggatcaaaaagtaacagcacagtctcatactgta
atggatacacctggaattgaaactaataatggtggttacaaccatccgttattaatccag
gaaccgctatcaagtcagtaccccaattttggggatgactatgagaacaggaatgttcaa
gcttttgccaatgacgataacaattattattcgaacggcaatcaaagtcacagtggagta
gaaaatgttgaagctggaccatccattccaccatcgggagtaagtacaaaactgctaccg
acggtgccgccggcgggatccaccggcaaaaaactgcccaccatcaatggcaaatccggg
ttgcttattaagcaaatgcctacagagatttttgacgatgagtcggacatcgaaattgaa
cttgatgctttggccgaccacgatcgcaactatggcatcgatggtgagcaggatgattac
tacttggacaaccagcagacgacaccgtcaatccggccgaatggttattatgaacacgta
ggtggtggttatgattaccgggaagattattttaacgaggaagacgagtacaagtacctc
gagcagcagagacagcagcagcagcaaagacagctaaaaaatacacaacaacagcagcac
aaaatgttgctctctcataatcagacctcattagactacattgatgaaggacaggacgaa
gactttacgtacgataattatcaaagtgaagaagacagcggcaattatttggatgagagc
tcaagcgggagtgtggctatcgttgacggtcggaaatcgcaaaagccggtacatacgacg
agggaaacacttctagctgaagcagatacttcggcaaccggtctgaatactttcaaatct
accgacatctctctgcagttgtcttcaattcatcagcaaatcaaaaagcaggatagtata
attatcgacgaatcagagccaaggaaaattgacccctgtgaaaatagacgcttgagtggc
tcagtacctacgcagcggtcccttgatctaagtccgccggaggaagaagccaatgaccaa
ttagccgatttggctgacttaagcagagtgaagtcgcaaaagaaacgtgtcttagtgcgt
ggtgaaacagaggaagtcgtcagtggacatatgcaaattttgcgaaaaactgagatcaca
gctagacaacgctggcattgggcctacaataaaataatcatgcaactaaacaatggtggc
ggcactggcgatgttggaatacgcaccaatggacatcctggcgataatccattttatagt
aacattgacagcatgccagatattcggcctcgtcgaaaatccataccccttgtttctgaa
ctgacaatggcggcaacaaaaagaaacgctggactaacatctgctgtgccgagggctact
cttaacgatgaggaattgaaaatgcatgtctacaaaaaagcacttcaggcgctgatctat
ccgatttcctcaacgacacctcataactttgtcctctggacagcaacgtcgccgacttat
tgctacgaatgcgagggtctgctttggggaattgctcgccagggcgtgcgctgtacagag
tgcggcgtaaagtgtcatgagaaatgcaaggacttgctgaacgctgactgtctacagcgt
gctgctgaaaagagctccaaacatggagccgaggacaaagcaaattctataattaccgcc
atgaaagaccgcatgaagcatcgagaacgagagaagccggaaatctttgaattgatcagg
atgacatttggtgtggatccagacacacacatagattcattagaacaagctgagcacgca
actgttgagggaacatctaaatggtcatgcaaactaacaatcacagtgatttgtgctcaa
ggcctgatagcgaaggataaaagcggtaccagtgatccttatgtgacggtgcaggttagc
aaagtcaaaaaacgaacgcgcacaatgccccaggagctaaaccctgtgtggaacgagaag
tttcactttgagtgccataactcgtcagaccgcatcaaagttcgcgtttgggatgaggac
aacgatctaaagtcaaagctgcgtcagaaactgactcgtgaatcagacgactttctcgga
cagacaataatcgaagttcgcactctatccggtgaaatggacgtgtggtataatctggaa
aaaagaactgacaaatcagcagtatcaggagctattcgccttcacatatctgttgaaata
aaaggcgaagaaaaggttgcaccctatcacgtgcagtacacttgcctccatgaaaatctt
tttcactacctttgtgaggaaaacagcggcatggttaaacttccaacacaaaaaggcgac
gatgcctggaaactgtatttcgatgaaatccctgaagaaattgtagacgagttctctatg
agatacggcatagagaatatataccaggcaatgacgcactttcactgtctgtcggctaag
tatctttgcccaggtgtacccgccgttatgagtacgctattggcgaacataaacgcgtat
tacgcccacaccaccgcctcttctgcagtttcagcaagtgaccgctttgcagcaagcaat
ttcgggaaagaaaaatttgttaagttgttggatcagttgcacaattctctcagaatcgac
ctgtctatgtatagaaataattttccggcatcgagtccagaaaagctgatggatttgaag
tctacagtggacctactaacaagcataacatttttccgcatgaaagtacaagaactgtcc
agtccaccgagggcaagcacggttgtcaaagattgcgtcaaggcctgtctacgatccacg
taccaatttttgtttgaaaactgctatgaactgtacaacagggaatttcaggtggacccg
aacgaagctaaacgtgcccctgatgaccacgagccaaagttagacagtgttgacttctgg
cataagctaattgctctaattgtgtccgtcattgatgaagacaaaaacagctatggcact
gtgctaaatcaattcccacaagagctgaacattggccaattgtcagcagcatctatgtgg
cacctctttgctgttgatatgaagtacgccctggaggagcacgaacagcatcgtctttgc
aaatcgtccgcttatatgaacttacactttcgggttaaatggttatatagcaattacgta
aaggaggtgcctccatacaaaggtgccgttcctgactatcccgcatggtttgaaccattt
gtgatgcaatggttaaatgagaatgatgatgtctccttggaatatcttcacggcgccttt
aatcgagacaaaaaggacgggtttcaaaagagcagtgagcacgcactgttctccaattca
gtagtcgacgttttcactcaattgacgcaatgtttcgatgttgttagcaagctcgagtgt
cctgatccagaaatttggaaacgttacatgaggcgttttgctaaaacaatcgtaaaagtg
ctaatagcctatgccgatattgtgaaaatggagtttccagagcatatgagagacgaaaga
attgcttgcatccttatgaacaacatacagcaattaagagtacagttggaaaaaatgttt
gagtcaatgggtggtgataagctagaagaagacgctgcaaacattctaaaggaattgcaa
caaaatttgaattcggctctagacgatttagcttgtctttttgccattagcctggagcct
cgcataacacagtcggtccgggagctgggtgacatgctgctctctataaaggggggcagt
ggaaaccttgttgccggcaaccaagctgcacaacgcaacgcagttgctgttgaagccgac
gaggtgctgcgacccttaatggatcttttagatggttctttgaccttgtacgcccagtca
tgcgaaaaaaccgtgttgaagcgcctgttgaaagagctttggaagattgtaatgcgtatt
ttggaaaagacaattgtgttgcctccaatgaccgataagactatgatgttcaaacacctc
accgacaatgctaaaaatctggcctctaatgctaaaatagaggatatgggtcgtctattt
aagtcgcacatggccggaaagcaggacgtgaaaagtgcccttagtggtgtcatggacatg
tcaaaggaggtggaaaagaatctttcacccaaacaatgtgccgtgcttgacgttgcctta
gatacaatcaaacagtacttccatgccggcggcaatggacttaagaaaacatttttagag
aagtcgcccgagttgcagagtttgcgatacgccctcagcctatacactcaaatgaccgac
acattgattaaaacattcatatccagtcaagtacatgaagttgatcccgagaatgctgag
gaaagcgtcggcgagatttcagtccagattgatctgttttctcacccaggtaccggagag
cacaaagttactgtgaaagttgtggctgccaacgatttgaaatgggttataccttctggt
atgtttcggcccttcgtcgaaatcaatctgattgggccacatttgcaggacaaaaaacga
aagtttgccactaaatcaaaatcgaacaactggtcaccaaagtacaatgaatcatttaac
ttcgccattggaaatgaggaacaacttgacttctttgaactacacatttgcgtgaaagac
tattgtttcgcacgagatgatcggttggtgggtgttgccgttattccactaaaggatata
tctgaaaaggggtcggtagcgtgttggttacctttgcaacgacgaatcgagatggacgaa
actggttggacaattctacggatactttcgcagagaagtaacgacgaggttgccaaggag
tttgtgaagcttaagtcagagattcgtcaggagccaactatgggtacttaa

DBGET integrated database retrieval system