KEGG   Drosophila willistoni: Dwil_GK13693Help
Entry
Dwil_GK13693      CDS       T01067                                 

Definition
GK13693 gene product from transcript GK13693-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dwil_GK13693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 429 aa AA seqDB search
MKTTWSWILLSALLLILGSPVISSRVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEPI
FALVAQALHATNVRVGRLDCTKYPAAAREFKVRVYPTIMFIKGNMEYSYSGDRSKDELVD
YALRMSGPPVQLVTRTESVDMLKGSHTIFFMFVGQQEGVVWDTYYAAAEGYQEHGFFYAT
SEDVAAQHFDFEKLPAVIVYKEEQHHFYPHGHIAHEMDPLEVNETIFQWVNVERFVLFPK
ITRFNIHQLLKTKKYLVVAVVQEDKLQQIASHELEFRDMVEGVIRKHRPRYHDQFQFGWI
GEPSIAHSIILDQLPTPHLIAINSTTQHHYIPDDDPMQMTPQALHLFLESISNESATAYG
GDTYFVRLNRALFEVRRSLKDMWQGNPVLTTVIFGLPLGFLSLIMYSIFCGDCLVTEEES
EEEGHEKKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacttggagttggatcctgctgagcgcattgctcttgatattgggatcgcca
gtgatatcctctagagtgttggagctgagcgatcgtttcattgatgtccgacatgagggt
cagtggctggtcatgttctatgccccctggtgtggttattgcaagaaaacagagccaata
tttgccctggtggcccaggctctacatgccactaacgtgcgagtgggacgtttagattgt
accaaatatccggcagcggccagagaattcaaagtacgcgtgtatcccaccataatgttt
ataaagggcaatatggaatacagctacagtggagatcgtagcaaagacgaactggtcgac
tatgccctgcgcatgtccggtccaccggtgcaattggtcacccgaactgaaagcgtggac
atgctaaagggttcgcatacgattttctttatgtttgtgggccagcaagagggcgttgta
tgggatacttactatgccgctgccgaaggatatcaggagcatggctttttctatgccaca
agtgaagatgtggccgctcagcatttcgatttcgaaaagctgccggcagtgattgtctac
aaggaggaacaacatcatttttatccacatggtcatattgctcatgagatggatcccctt
gaggtgaatgagaccatcttccagtgggtgaatgtggagagatttgtactattccccaaa
atcacacgctttaatatccatcagttgctaaagaccaaaaaatatttggttgtagctgtg
gtgcaagaggacaaactgcaacaaattgcaagccatgagcttgaattccgtgatatggtt
gagggtgtgataaggaagcatcgaccacgctatcatgaccaattccaattcggttggatc
ggtgaaccttcgatagctcattccattatactcgaccaactgcccactccacatttaata
gctataaattcaacaactcaacatcattacattccggacgatgatccaatgcaaatgacc
ccacaggccttgcatttgttcttggaatcgattagcaatgagagcgcgactgcctatggc
ggtgatacctattttgtgcgtctcaatcgtgccctgtttgaggtgcggcgctccttaaag
gacatgtggcagggcaatcccgtactgaccactgtcatctttggactgcccctcggtttc
ctttcactcatcatgtattccattttctgcggcgattgtctggtcaccgaagaagagtcc
gaagaggaaggccacgagaagaaagagtaa

DBGET integrated database retrieval system