KEGG   Drosophila willistoni: Dwil_GK13781Help
Entry
Dwil_GK13781      CDS       T01067                                 

Definition
GK13781 gene product from transcript GK13781-RA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dwi  Drosophila willistoni
Brite
Enzymes [BR:dwi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dwil_GK13781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 226 aa AA seqDB search
MAWRSVGASNEDLIRQLKEYGVIGSDAVAKAMIETDRKFYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDHLQPGAHILDVGSGSGYLTACFYRYVKAKGDHPNTKIVGIEHQSSL
VQMSKANLNADDRSMLDSEKLIIVEGDGRKGHPSHAPYQAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPEGGSQYMQQYDKDANGKVQMTRLMGVMYVPLTDLRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgttccgtaggtgctagcaatgaagatcttatacgccaattaaaggaatac
ggcgtcattgggagcgatgcagtcgccaaggccatgatagagacagatcgcaagttctat
tcgcctcgaaatccctatatggatgctccccaacctataggaggcggtgtaaccatcagt
gctccacatatgcatgcctttgctttagaatatttaagagatcatttgcaacctggagcc
catatccttgatgtgggctctggttccggctatttgacggcctgtttttatcgttacgtc
aaggcaaaaggtgatcatccaaataccaaaattgtgggaatcgaacatcaatcgtcgctg
gtgcaaatgagtaaagctaatttgaatgccgatgatcgctccatgttagattcggagaaa
ctaatcattgtggaaggcgatggacgaaagggtcatcctagccatgcaccatatcaggcc
attcatgttggagctgctgctccagatacgcccaccgaattgatcaatcaattggccaat
ggaggcagactgattgtaccagtcgggcctgaaggtggctctcagtatatgcagcaatat
gacaaggatgccaatggaaaagtgcagatgacccgccttatgggcgttatgtatgttccc
ctaacggacttgcgctcctga

DBGET integrated database retrieval system