KEGG   Drosophila willistoni: Dwil_GK13797Help
Entry
Dwil_GK13797      CDS       T01067                                 

Definition
GK13797 gene product from transcript GK13797-RA
Organism
dwi  Drosophila willistoni
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKLVQVEVDLVTS
KEQLEKANTELEEKEKLLTATESEVATLNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
HAEKQVKRLQKEVDRLEDRLFHEKEKYKAICDDLDQTFAELTGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgat
aaggcagatacctgtgaaaatcaagctaaggatgccaactcccgcgccgataaactcaat
gaggaggtgcgcgatctggaaaagaaattggtccaggttgaggtcgatttggtaacatcc
aaggaacaattggagaaggccaacaccgagctggaggagaaggaaaaattgttgaccgcc
acggagtctgaggtcgccaccttgaaccgtaaggtgcaacagattgaagaggatttggaa
aagtcggaggaacgctcaaccaccgcacaacagaagctgttggaggccacacaatcggct
gatgagaacaaccgtatgtgcaaagtattggagaaccgttcccaacaggatgaggagcgt
atggatcagttgaccaatcaattgaaggaagctcgcatgttggctgaggatgccgatacc
aagtccgatgaagtgtcccgcaagctggccttcgttgaagatgagctcgaagtggctgag
gatcgtgtccgttcgggcgagtccaagatcatggagctggaagaagagttgaaggttgtc
ggtaactctctgaaatccctggaagtgtccgaggagaaggccaaccagcgtgttgaggaa
ttcaagcgtgaaatgaagaccttgtccatcaagttgaaggaagccgaacagcgcgccgaa
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaagaccgtctc
ttccatgagaaagaaaaatacaaagcaatctgcgatgatttggaccagacatttgctgaa
cttactggatattaa

DBGET integrated database retrieval system