KEGG   Drosophila willistoni: Dwil_GK13861Help
Entry
Dwil_GK13861      CDS       T01067                                 

Definition
GK13861 gene product from transcript GK13861-RA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dwi  Drosophila willistoni
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 407 aa AA seqDB search
MAQIEEYQDLVLDALEVVEFKLIRDKADADINNDAIPGFHPVMAHQIFGESETIFGYQDL
RVRILYTAGPLHIYLGVEYGKRVNEISDGEIKADDVVATIAQSLPDGCYFINLDEFLKTL
DKADKFQPFGEKISEYKQQSEDGTERLFEIYQCDYKSSSFLKFFARLQTFILWFVDAASY
IDTDDPQWCYFICYEKYKNNDGQYQYATAGYSTVYEYYAYPQNKRPRISQMLILPPFQKL
GLATQMVKTIYQFYQSQKNVVDITVEDPSEDFQRLRNFVDARYCKDLKSFARNELIKGFN
KEMVREARETLKLNPRQVRKVYELMRLYYTNVNDDKEYKAYRLEVKKRLNAVYYKQLKDL
KKMERYKMDTEMLRARLPSTKQRMEQLQEEYTLVEQDYKNTIAKLKA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaattgaagaatatcaagacttggtcttggatgccctggaggtggtcgagttc
aagctgatacgtgataaagcagacgccgacatcaataatgatgccatccccggatttcac
ccggttatggctcatcagatttttggcgaatccgagactatatttggatatcaggacttg
cgtgtgcgtatcctttataccgccggtccattgcacatatatttgggcgtggagtacggc
aagcgggtaaatgaaatttctgacggcgaaatcaaggcagacgatgtggtcgccaccatt
gcccagagccttccggatggctgctatttcatcaatctcgatgaatttttaaagactctg
gacaaagccgataaattccagccattcggtgagaagatcagcgagtataagcagcaatcc
gaagatggcaccgagagactatttgagatctatcagtgtgattataaatcgtcatcgttc
cttaagttctttgcgcgtctgcagacattcatactttggttcgtggatgctgcctcatac
atagacactgacgatcctcaatggtgttattttatttgctatgagaagtacaagaacaat
gatggacagtatcaatatgccacagctggatactcgactgtctatgagtactatgcctat
ccgcagaacaagagaccaagaattagccaaatgttgatacttccacccttccagaaatta
ggtctagccactcagatggtaaaaaccatttaccagttttatcaatctcagaagaatgtg
gtagatattaccgttgaggatccatcggaggatttccagcgtttacgcaactttgtggat
gctcgatactgcaaggatctaaagtcctttgcccgcaatgaattaatcaagggattcaac
aaagaaatggtaagggaggctcgtgaaactttaaaacttaatccacgccaggtgcgcaaa
gtttatgaacttatgcgtctatactataccaatgtgaacgatgataaggaatacaaggca
tataggctagaggtcaagaagcgtctcaatgccgtctattataaacaactgaaggatcta
aagaaaatggaacgctacaaaatggatacggaaatgttgcgggcacggctgcccagtaca
aagcagcgcatggaacagcttcaggaggagtacacgctcgtcgagcaggactataagaat
acaattgccaagttgaaagcctga

DBGET integrated database retrieval system