KEGG   Drosophila willistoni: Dwil_GK13932Help
Entry
Dwil_GK13932      CDS       T01067                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dwi  Drosophila willistoni
Pathway
dwi01040  Biosynthesis of unsaturated fatty acids
dwi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dwi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dwil_GK13932
Enzymes [BR:dwi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dwil_GK13932
Lipid biosynthesis proteins [BR:dwi01004]
 Desaturase
  First
   Dwil_GK13932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 6650869
NCBI-ProteinID: XP_002073057
FlyBase: FBgn0215938
UniProt: B4NKB3
Position
Unknown
AA seq 415 aa AA seqDB search
MTPNLIGSTFILAETAIADGNNNKMAAPASASGASAAVKSSTIKSKESSVAKATEAKVSP
AVKPYEMEIVWHNVVLFIILHSMALYGGYLIYAESAYLEIVPIYITMFLGGLGITAGVHR
LWSHKAYKAKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFVDTHADPHNSRRGFFFAH
MGWLMCKKHPDVTSKGKQIDMSDIEQDPVVMFQKKFYFIIMPICCFVLPMLFPYYCMGTS
LRVCFFTCSILRYTFSLHGTWLVNSAAHFYGMKPYDVNISSVNTKLVSTITFGEGWHNYH
HVFPWDYKAAELGTYGYNWTTAFIDVMAKIGQAYDLKFVSKDMVHKRVLRTGDGSHIAAL
IDANNNDTAPSNELVAHLDHDLEETAVWGWDDKDISEEDRQGASIVNSELECKQD
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaatttaataggcagcacctttatattggccgaaacggcaattgccgatggt
aacaacaataagatggccgctcccgcttccgcttctggagcgtcagcagctgtgaaatcg
tcaacgatcaagagcaaggagtcctcggtggccaaggccactgaagcaaaggtatcacca
gctgttaaaccctatgaaatggaaattgtctggcataatgttgtcctcttcatcattctc
cactcgatggccttatatggaggatatttgatctatgccgaaagcgcgtatctggagata
gtgccaatttatataaccatgtttttgggcggattgggcattacggctggagtgcatcgt
ctatggtctcacaaggcttacaaagcaaaattgccattgcgcatcttcctcatgctgtgc
caatcgttggccttccagaacagcatttgggaatggacacgtgatcatcgtgtgcatcac
aagtttgtcgatacacatgccgatcctcacaattcgcgtcgtggcttcttctttgcccac
atgggttggctgatgtgcaagaagcatcccgatgtcaccagcaagggaaaacaaattgat
atgagtgatattgaacaggatcccgtggttatgttccaaaagaaattctactttattatt
atgccaatttgctgctttgttctgcccatgttgttcccatactattgcatgggcacatcg
ctgcgcgtctgcttcttcacctgctccattctgcgttataccttctcgttgcacggcaca
tggttggtcaacagtgctgcccatttctatggcatgaaaccctacgatgtcaacatcagc
tcggtgaacactaaactcgtgtcgaccatcaccttcggcgagggatggcataactatcat
catgtcttcccctgggattacaaagcagctgaattgggcacttatggctacaactggacc
acagctttcattgatgtgatggcaaagattggtcaagcctacgatctgaagtttgtgtca
aaggacatggtccacaagcgtgtcctgcgtactggagatggttcacatattgctgctcta
atcgatgccaataacaatgatacagctccttctaacgaattggttgcccatctggatcat
gatctggaggagactgccgtttggggctgggatgacaaggatattagcgaagaggatcgc
cagggtgcttcaattgtaaacagtgagctcgaatgcaaacaggattag

DBGET integrated database retrieval system